KEGG   Dechloromonas aromatica: Daro_0166Help
Entry
Daro_0166         CDS       T00259                                 

Definition
homoserine kinase (EC:2.7.1.39)
Orthology
K02204  
homoserine kinase type II [EC:2.7.1.39]
Organism
dar  Dechloromonas aromatica
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:dar01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:dar00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
182465..183391
Genome map
AA seq 308 aa AA seqDB search
MSVYTKVGRDELAAWLQPLGLGELIDHAGIAAGMQNSNYFVTTTSGRFVLTLFERVDLSA
LDFYLALQDTLAQRGIPCPQPLADGGGRYWRMLCDKPAALLTCLSGAALETPGAAHCHAV
GAMLAHLHLAAANMPNPLPNPCGANWRQTVGAALLPLVSAEEHDLLADELAYQALQDWSK
LPRGVIHADLFRDNVLWDSTGRLTGVLDFYFAGEDAWLFDLAVVANDWCFDETTLATLLA
GYTTQRPLIEAERAAWPAMRRAAALRFWLLRLEVRHQPRAGEVVTIKNPDDFRHLLARFR
LAPEALPR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgtctataccaaggtcgggcgggatgaactcgccgcctggctccagccgctaggg
ctgggcgagttgatcgaccatgccggcattgccgccggcatgcagaactccaattacttc
gtgacgaccaccagcggtcgtttcgtgctcacgctgttcgaacgtgtcgacctctcggcg
ctggatttttatctggccttgcaggacacgctggcccagcgcggcatcccttgtccgcag
ccgctggccgatggtggtgggcgttactggcgaatgctgtgcgacaagcccgccgccctg
ctcacctgtttgtcaggcgcggcacttgaaacacccggcgccgcccattgtcacgccgtc
ggcgcaatgctggcccacttgcatctggcggcggccaacatgccaaatccactgcccaac
ccctgcggcgccaattggcgccagaccgtcggcgcagccttgttgccgctagtatcggct
gaagagcatgacctgctggccgatgagctggcctatcaggcgttgcaggactggtcgaag
ctgccaaggggtgtcattcacgccgaccttttccgcgacaacgtgctctgggactcgacg
ggccgactgaccggcgtgctggatttttattttgccggcgaggacgcctggctgtttgat
ctggccgtcgtggccaacgactggtgttttgacgaaacgacactggccacattgctggcg
ggttataccacccagcgccccttgatcgaggcagaaagggccgcctggcccgccatgcgg
cgggcagccgccttgcgtttctggctgctccgtttggaggtgaggcaccagccacgggcc
ggagaagtggtaacgatcaagaatccggatgactttcggcacctgctggcccgttttcgc
cttgctccagaagccctcccccgttag

DBGET integrated database retrieval system