KEGG   Dechloromonas aromatica: Daro_0488Help
Entry
Daro_0488         CDS       T00259                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dar  Dechloromonas aromatica
Pathway
dar00480  Glutathione metabolism
dar00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Daro_0488
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Daro_0488
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Daro_0488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAZ45245
JGI: Daro0488
UniProt: Q47IT6
Position
550893..551450
Genome map
AA seq 185 aa AA seqDB search
MFSSLKRCFGIAALITVGVVPVAAAAECPPLLNHSFASLQDGKPMPLCQYAGKVILVVNT
ASYCGFTSQYDGLEKLYARLKDKGLVVLGFPSNDFGEQEPGSEKEIADFCRLTYGVEFPM
VSKTVVKGKGAHPFYLKLAEITGSKPKWNFHKYLINRDATQVVAYTSFTKPDDKDLLKKI
DEFLK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttctctagcctgaaacgctgctttggaattgccgccctgattacggtgggggtcgtg
cctgttgcggctgccgctgaatgcccgccactgctcaatcacagcttcgccagcctgcag
gatggcaagccgatgccgctctgccagtacgccggcaaggtcattctggtcgtcaatacg
gccagctactgcggtttcacctcgcaatacgacgggctggaaaagctgtatgcccggctc
aaggacaagggcctggtggtgcttggttttccatccaatgactttggcgaacaggaaccg
ggcagcgagaaggaaattgccgatttctgccggctgacctacggcgtcgagtttccgatg
gtcagcaagacggtggtcaagggcaagggcgctcacccgttctacctgaagctggccgag
atcaccggcagcaagccgaagtggaatttccacaagtacctgatcaaccgcgatgcgacg
caagttgttgcctacaccagcttcaccaagccggatgacaaggacttgctgaagaaaatc
gacgaattcctcaaataa

DBGET integrated database retrieval system