KEGG   Dechloromonas aromatica: Daro_0488Help
Entry
Daro_0488         CDS       T00259                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dar  Dechloromonas aromatica
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:dar00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:dar00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
550893..551450
Genome map
AA seq 185 aa AA seqDB search
MFSSLKRCFGIAALITVGVVPVAAAAECPPLLNHSFASLQDGKPMPLCQYAGKVILVVNT
ASYCGFTSQYDGLEKLYARLKDKGLVVLGFPSNDFGEQEPGSEKEIADFCRLTYGVEFPM
VSKTVVKGKGAHPFYLKLAEITGSKPKWNFHKYLINRDATQVVAYTSFTKPDDKDLLKKI
DEFLK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgttctctagcctgaaacgctgctttggaattgccgccctgattacggtgggggtcgtg
cctgttgcggctgccgctgaatgcccgccactgctcaatcacagcttcgccagcctgcag
gatggcaagccgatgccgctctgccagtacgccggcaaggtcattctggtcgtcaatacg
gccagctactgcggtttcacctcgcaatacgacgggctggaaaagctgtatgcccggctc
aaggacaagggcctggtggtgcttggttttccatccaatgactttggcgaacaggaaccg
ggcagcgagaaggaaattgccgatttctgccggctgacctacggcgtcgagtttccgatg
gtcagcaagacggtggtcaagggcaagggcgctcacccgttctacctgaagctggccgag
atcaccggcagcaagccgaagtggaatttccacaagtacctgatcaaccgcgatgcgacg
caagttgttgcctacaccagcttcaccaagccggatgacaaggacttgctgaagaaaatc
gacgaattcctcaaataa

DBGET integrated database retrieval system