KEGG   Dechloromonas aromatica: Daro_0489Help
Entry
Daro_0489         CDS       T00259                                 

Definition
GTP cyclohydrolase (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dar  Dechloromonas aromatica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daro_0489
Enzymes [BR:dar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Daro_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
551476..552276
Genome map
AA seq 266 aa AA seqDB search
MNAPENIFLPDVQAAADTRRLAIQSVGVKGLRYPLQLENAAGELTSTVATFAMSVGLPPE
VKGTHMSRFVELLEARTGPLTQVGLLRMMADMLLRLDASSGRIELAFPYFIRKMAPVSGV
ESLLDYDATLIVDQRAWESATLTLRVVAPVTSLCPCSKKISDYGAHNQRSHITLEARLRS
PMSIEDLVRIAEEEASCEVFGLLKRPDEKWVTERAYDNPKFVEDLVRDIALRLMNEPRIA
EWKVASENFESIHNHSAYAELYGCNE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccccggaaaacatctttctgcccgacgtccaagccgccgccgatacgcgccgc
ctcgccatccagagcgtcggcgtcaagggcttgcgctatcccctgcaactggaaaatgcg
gccggtgaattgaccagcacggtcgcgacctttgcgatgagcgtcggcttgccgcctgag
gtcaagggcacgcacatgtcacgtttcgtcgagttgctcgaagcccgcactggccctctg
acgcaagtcggcctgctgcgcatgatggccgacatgctgctgcgtctggatgccagcagt
ggccgcattgaactggctttcccttacttcatccgcaagatggcgccggtctccggtgtc
gagagcctgctcgactacgatgcgacgctgatcgtcgatcagcgcgcatgggaaagcgca
acgttgaccctgcgcgtcgtggcgccggtaaccagcctgtgcccctgctccaagaagatt
tccgattacggcgcccacaaccagcgttcgcatatcacgctggaggcgcgactgcgttcg
ccaatgagcatcgaggatctggtgcgtattgccgaggaagaggcgtcctgcgaggtcttc
ggcctgttgaagcggccggacgaaaagtgggtgaccgagcgtgcctacgacaacccgaag
ttcgtcgaagacctcgtccgcgacatcgcgctgcgcctgatgaacgagccgcgcatcgcc
gaatggaaggtggcttccgagaacttcgagtccatccacaaccactcggcctacgccgaa
ctgtacggctgcaatgagtaa

DBGET integrated database retrieval system