KEGG   Dechloromonas aromatica: Daro_0586Help
Entry
Daro_0586         CDS       T00259                                 

Definition
glycogen branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dar  Dechloromonas aromatica
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Daro_0586
Enzymes [BR:dar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Daro_0586
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Daro_0586
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
657897..659762
Genome map
AA seq 621 aa AA seqDB search
MQHADALYLFNEGRNNQAYRLLGAHADISGTTFRVWAPNASRVSVVGDFNGWHGDVHQLH
PLGESGVWEIAVAEAHTGNLYRFEITNRHTGDKLIKSDPYGRGFELRPGSAAYVVPPSMH
VWGDADWLQQRAGWDWQQAPVNIYEVHPGSWMRHPDGKPYLWGELAERLIPYALAQGYTH
LELLPITEHPLDESWGYQTTGYFAPTSRYGSADELRAFVDACHQAGLGVLLDWVPGHFPQ
DDWALARFDGTALYEHEDPRLGLHADWGTHIFNYGRHEVRSFLMSSAHWWLSEFHFDGLR
VDAVASMLYLDYSRKHGEWLPNKFGGRENLEAIDFLKQLNAMVHGDFPGALTIAEESTAW
PMVSRPTYVGGLGFSMKWNMGWMNDSLRYFHRDPIYRRWHHSELTFGQIYAYSENYVLPF
SHDEVVHGKGSLLGKMPGDTWQRYANLRLLLAWQVLTPGKKLMFMGCEFGQQGEWSEGRE
LDWGSLANPENAAAQRLSADLNRLYRDLPALHTQDFSALGFEWIDCNDSEHSVLSWLRWG
KDGSFVVVVFNFTPVPQPAYRLGVPEAGTYVELLNTDSAFYGGSNLGNGGALTATKGEWM
GRPANLEVTIPPLGAVVLRRE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcagcatgccgacgcactttatctgttcaacgaaggccgaaacaatcaggcttatcga
ttgctcggcgctcacgccgatatttccggcaccaccttccgggtctgggcaccaaacgcc
agccgggtttcggtggttggcgatttcaacggttggcatggcgatgtgcaccaactgcat
ccgctgggcgaatccggcgtttgggaaattgctgtcgccgaggcgcatactggcaacctt
tatcgcttcgaaatcaccaatcgccacaccggcgacaagctgatcaagagcgacccctat
ggccgtggcttcgaactgcgcccgggctcggcagcctatgtcgtgccaccgtcgatgcac
gtctggggcgacgccgactggctgcagcaacgcgccggctgggactggcagcaggccccg
gtcaatatctacgaagtgcatcccggttcgtggatgcgccaccccgacggcaagccctat
ctttggggagagctggctgagcgactgattccctacgcgctggcgcagggctacacccac
ctcgaactgctgccgatcaccgagcatccgctcgacgagtcctggggctaccagacgacc
ggctatttcgcaccgacctcgcgctacggctcggccgacgagctacgtgccttcgtagac
gcctgccaccaggcaggtctgggcgtgctgcttgactgggtgcccggccatttcccgcag
gacgactgggccctggcccgcttcgacggcacggcgctttacgaacacgaagacccgcgc
ctcggcctgcatgccgactgggggacgcatatcttcaactacggtcggcacgaggtgcgc
agtttcctgatgtcgtcggcccactggtggctgtccgaattccatttcgatggcctgcgc
gtcgacgccgtggcctcgatgctttatctcgactattcacgcaaacatggcgaatggctg
cccaacaagttcggcgggcgggaaaacctggaagccatcgacttcctgaaacagctcaat
gccatggtgcacggcgatttccccggggcactgaccattgcggaagaatcgacggcctgg
ccgatggtttcccggccgacctatgtcggcggccttggtttctcgatgaaatggaacatg
ggctggatgaacgacagtctgcgctattttcatcgcgacccgatctaccgccgctggcac
cacagcgaactgaccttcgggcagatttacgcctacagcgaaaactacgtgctgcctttc
tcgcatgacgaagtggtgcacggcaaaggctcgctactcggcaagatgcctggcgatacc
tggcaacgctacgccaacctgcgcctgctgctcgcctggcaggtcctgacgccgggcaag
aagctgatgttcatggggtgtgagttcggccagcaaggcgaatggtccgaaggtcgcgaa
ctcgactggggctcgctggccaatccggaaaatgctgccgcacaacgcctgtcagccgat
ctcaatcgcctgtatcgcgacttgccggcgctgcacacccaggatttcagcgccctcggc
ttcgagtggatcgactgcaacgacagcgagcactcggtgctgtcgtggctgcgttggggc
aaggatggcagctttgtcgtcgtcgtcttcaacttcacgcccgtgccgcaacccgcctat
cgtctcggcgttcccgaggcgggcacctatgtcgaactgctcaataccgattccgccttc
tacggcggcagcaacctcggtaacggcggtgcgctaactgcaaccaaaggtgagtggatg
ggccgtccggccaatctggaagtgaccatcccgccactgggggcggtggtcttgcggcgc
gagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system