KEGG   Dechloromonas aromatica: Daro_0592Help
Entry
Daro_0592         CDS       T00259                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
dar  Dechloromonas aromatica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daro_0592
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_0592
   00052 Galactose metabolism
    Daro_0592
   00500 Starch and sucrose metabolism
    Daro_0592
   00520 Amino sugar and nucleotide sugar metabolism
    Daro_0592
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Daro_0592
   00524 Butirosin and neomycin biosynthesis
    Daro_0592
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Daro_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(662508..663437)
Genome map
AA seq 309 aa AA seqDB search
MLLGGDLGGTKTLLALAEVIDGRIEIVRQQRYASLDYASFDDLLAEFIAGHPAINTACFG
VAGPTDGRHAKLTYLPWQLTASELEQKFAIGRVSLINDFAAAANGLPLVDDQDILTLHTG
QPEEHAPRVILGAGTGLGVAGLIWESDRYRVIPGEGGHFGFSPQTAQQGELWAWLLAQNG
RVTVEDIVSGPGLSRIFAFLSGQTRAPEEIGRAALAGIDPSANAALQLWLECYGAFAGDL
AMHWLARGGVYLAGGIAAKLLPHIDASSFTAAFLAKREHSELVKSMPIRLLTVEDLGLRG
TLARAAQQD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcggcggcgatctcggcggcaccaagacgctgctggcactggccgaagtgatt
gatggccgcatcgagattgtccgccagcaacgctacgccagcctggattacgccagcttc
gacgacctgctggctgaatttatcgccgggcacccggccatcaataccgcctgcttcggc
gtcgccggcccaaccgatgggcgccatgccaagctgacctacctgccctggcaactgacc
gccagcgagctggagcaaaagttcgccatcggccgcgtctcactgatcaacgattttgcc
gctgctgcgaacggcctacccttggtcgacgaccaggacatcctgaccctgcacaccggc
cagcccgaagaacacgccccgcgtgtcattctcggcgccggcactggcctcggcgtggcc
gggctgatctgggaaagcgaccgttatcgcgtcatccccggcgaaggcggtcacttcggc
ttctcgccgcaaaccgcacagcaaggcgaactctgggcctggctactggctcaaaacggc
cgggttactgtcgaagacatcgtttccggccctggcctgtcacggatttttgctttcctt
tccggtcaaacgcgtgcaccggaggaaatcggacgagccgccctcgccggtatcgatccg
tcagccaatgcggcgttacagctctggcttgaatgctatggcgccttcgccggcgacctc
gccatgcactggctggcccgaggcggcgtctatctggccggcggcatcgccgccaaacta
ttgcctcacatcgatgccagctccttcacggcagccttcctggccaaacgcgagcacagc
gaactggtcaagagcatgcccatccggctgctgaccgtggaagacctcggcctgcgcggc
acattggcgcgagccgcccaacaagactga

  All links  
No link information was found.   
DBGET integrated database retrieval system