KEGG   Dechloromonas aromatica: Daro_0592Help
Entry
Daro_0592         CDS       T00259                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dar  Dechloromonas aromatica
Pathway
dar00010  Glycolysis / Gluconeogenesis
dar00052  Galactose metabolism
dar00500  Starch and sucrose metabolism
dar00520  Amino sugar and nucleotide sugar metabolism
dar00521  Streptomycin biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
Module
dar_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_0592
   00052 Galactose metabolism
    Daro_0592
   00500 Starch and sucrose metabolism
    Daro_0592
   00520 Amino sugar and nucleotide sugar metabolism
    Daro_0592
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Daro_0592
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Daro_0592
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Daro_0592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: AAZ45349
JGI: Daro0592
UniProt: Q47II2
Position
complement(662508..663437)
Genome map
AA seq 309 aa AA seqDB search
MLLGGDLGGTKTLLALAEVIDGRIEIVRQQRYASLDYASFDDLLAEFIAGHPAINTACFG
VAGPTDGRHAKLTYLPWQLTASELEQKFAIGRVSLINDFAAAANGLPLVDDQDILTLHTG
QPEEHAPRVILGAGTGLGVAGLIWESDRYRVIPGEGGHFGFSPQTAQQGELWAWLLAQNG
RVTVEDIVSGPGLSRIFAFLSGQTRAPEEIGRAALAGIDPSANAALQLWLECYGAFAGDL
AMHWLARGGVYLAGGIAAKLLPHIDASSFTAAFLAKREHSELVKSMPIRLLTVEDLGLRG
TLARAAQQD
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcggcggcgatctcggcggcaccaagacgctgctggcactggccgaagtgatt
gatggccgcatcgagattgtccgccagcaacgctacgccagcctggattacgccagcttc
gacgacctgctggctgaatttatcgccgggcacccggccatcaataccgcctgcttcggc
gtcgccggcccaaccgatgggcgccatgccaagctgacctacctgccctggcaactgacc
gccagcgagctggagcaaaagttcgccatcggccgcgtctcactgatcaacgattttgcc
gctgctgcgaacggcctacccttggtcgacgaccaggacatcctgaccctgcacaccggc
cagcccgaagaacacgccccgcgtgtcattctcggcgccggcactggcctcggcgtggcc
gggctgatctgggaaagcgaccgttatcgcgtcatccccggcgaaggcggtcacttcggc
ttctcgccgcaaaccgcacagcaaggcgaactctgggcctggctactggctcaaaacggc
cgggttactgtcgaagacatcgtttccggccctggcctgtcacggatttttgctttcctt
tccggtcaaacgcgtgcaccggaggaaatcggacgagccgccctcgccggtatcgatccg
tcagccaatgcggcgttacagctctggcttgaatgctatggcgccttcgccggcgacctc
gccatgcactggctggcccgaggcggcgtctatctggccggcggcatcgccgccaaacta
ttgcctcacatcgatgccagctccttcacggcagccttcctggccaaacgcgagcacagc
gaactggtcaagagcatgcccatccggctgctgaccgtggaagacctcggcctgcgcggc
acattggcgcgagccgcccaacaagactga

DBGET integrated database retrieval system