KEGG   Dechloromonas aromatica: Daro_0787Help
Entry
Daro_0787         CDS       T00259                                 

Definition
(GenBank) GGDEF protein
  KO
K13590  diguanylate cyclase [EC:2.7.7.65]
Organism
dar  Dechloromonas aromatica
Brite
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Daro_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GGDEF Lebercilin IL3 DUF4093 Snapin_Pallidin Cas_Csa4 Fib_alpha DUF4874
Motif
Other DBs
NCBI-ProteinID: AAZ45543
JGI: Daro0787
UniProt: Q47HY8
Position
complement(854055..855812)
Genome map
AA seq 585 aa AA seqDB search
MTTLTNPFEIARETLRLLATRRIPPSPDNYLTLYHEIAGTKPTENSFPESQLRSLAAALP
KASPDQLRLARQLDEAVKAANWEDFKKALTDFISALAESQKLSWSELITDLLRQWDAKHP
GLTAARKRESLEHILTSSGANPDILFNRLQSLLRAWGHGKETEAASLSEEAASETTPTRA
LTAATSDLLPELRKLFAFTLETAIATQLLESPQLSSDAKVLANDIRTAVSPAQLQEFLTR
LKRFAFKLELLAEDQAELRHSLLNLLRLLVGNITELVLDDHWLHGQIAVVREIIDKPLSQ
RALDDAESRLKEVLFKQAQLKASLSEARDAIKHMLAGFVDHLADFADATSDYHDKIESCA
EKISSSKDITELEDVLGEVMRETRTIQINAQRSRDELRSTQQKVQESEARIQELERELVA
SSDLVRHDQLTGTLNRRGLEEIFTKEAARATRHDTALCVALIDIDNFKKLNDSMGHDTGD
QALIHLATICRETLRPQDTVARYGGEEFIILLPETSLDDAAIALTRLQRELTKKFFLHGN
EKVLITFSAGVTQMLPNDTQATVIKRADEAMYQAKKTGKNRVTTA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaccacactcaccaaccctttcgaaatcgcccgggagacattgcgcctgctggcaacc
cgaagaatccccccctctccggacaactatctcaccctctaccacgagattgccggcaca
aaaccaaccgaaaattcgtttcccgaatctcaactacgctcgctggcagcagccttaccg
aaagcatcaccagatcagcttcgcctggcccggcaattggacgaggctgtcaaggcagcc
aactgggaggactttaaaaaggcactgactgatttcatctcagccctcgctgaatcgcaa
aaactgagttggtctgaactcattactgacttgctgcgccagtgggatgccaagcaccca
gggctgaccgctgcccgaaaacgcgaatcactggaacatatactgaccagtagcggcgcc
aatccggatatcctgttcaaccgactgcaaagccttttgcgcgcatggggtcacggcaag
gagacagaggccgcctccctgtccgaagaagcagcctcggagacaaccccaacacgcgca
ttaaccgcagcaacgagtgatctgctacctgaattacgcaagctgtttgcctttaccctc
gaaaccgccatcgccacccagttactcgaaagcccccaactctcgagcgatgcaaaagta
ctggctaacgacatccgtactgccgtcagcccggcacagttgcaggaattcctcactcgc
ctcaagcgctttgctttcaaacttgaattgctcgccgaagaccaggccgagctacgccac
agtctccttaacctgctccgcctgctcgttggcaacatcacagaactcgtcctcgatgac
cactggctgcacggacaaatcgccgtcgtgcgtgaaatcatcgacaagccgctctcccag
cgcgccctcgacgatgctgaaagccgcctgaaagaagtactgttcaagcaggcacaactc
aaggccagcctgtccgaagcccgcgacgccatcaagcacatgctcgccggctttgtcgac
catctggccgacttcgcagacgccacctccgactaccacgacaagattgaaagttgcgct
gaaaaaatcagttcatccaaagacatcaccgaactggaagacgtccttggcgaagtcatg
cgggaaacacgcaccatccagatcaacgcccagcgttcccgcgatgaactacggtcgacc
cagcaaaaagtacaggaatcagaagcgcggattcaagaactcgaacgcgaactcgtcgcc
agcagcgacctcgtccgccatgaccagctaaccggcacactcaaccgccgagggctggaa
gaaatcttcaccaaagaagctgcccgggccacccgccacgacactgcgctctgcgtggca
ttgatcgacatagacaacttcaaaaaactgaacgactcgatgggtcacgacaccggcgac
caggccctgatccatctcgccaccatctgcagggaaaccctccgcccgcaggacaccgtt
gcccgttacggtggcgaagagttcatcatcctcctgcctgaaacctcactggacgatgct
gccatcgccctcacccgactccagcgtgagctaaccaaaaagttcttcctgcatggtaat
gagaaagtattgatcactttcagcgccggcgtcacacaaatgctccccaacgacacacaa
gcaacagtaatcaaacgggcggatgaggcgatgtatcaggcaaagaaaacaggcaaaaac
cgggttactactgcgtaa

DBGET integrated database retrieval system