KEGG   Dechloromonas aromatica: Daro_0808Help
Entry
Daro_0808         CDS       T00259                                 

Definition
(GenBank) RecR protein
  KO
K06187  
recombination protein RecR
Organism
dar  Dechloromonas aromatica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daro_0808
DNA repair and recombination proteins [BR:dar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Daro_0808
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Daro_0808
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
877924..878523
Genome map
AA seq 199 aa AA seqDB search
MNPSGLESLIEALRCLPGIGPKSAQRMAYHLLQRDRPGAQRLGDAVLHALQAIRHCQRCN
TFTEGDICERCASPRRDPELLCVVETPVDMNMMEQTLTYRGMYYVLMGKISPLDGVGPKE
LGLDRLMTRALDGVVKEVILATNYTNEGEATAHYITAMLKPKGVGVTRIARGVPVGGELE
YVDSGTLAQALRERKICGD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgaatccttcgggtcttgagtctttgatcgaggcgttgcgttgcttgcccgggatcggg
ccgaaatcggcgcagcgcatggcttaccacttattgcaacgtgatcggcccggagctcag
cgtctgggggatgcggttctgcatgcattgcaggcgatccggcattgtcaacgatgcaat
acctttactgaaggcgatatttgcgaacgttgtgcttctccccggcgagatcctgagctc
ctttgcgtggtggaaactcccgttgatatgaacatgatggagcagaccctgacttatcgg
ggtatgtattatgttttgatgggcaaaatctctccgctggatggtgtcggtcccaaggag
ttggggttggatcgtttgatgactcgagcgctcgacggggtcgttaaggaggttattttg
gcgaccaactacaccaatgaaggtgaggcgaccgctcattacatcaccgccatgctcaag
ccaaagggggttggggtgacgagaattgcgcgcggtgtacccgtcggaggagagcttgag
tatgtcgacagcggcacgctggcccaggctttgcgcgaacgcaagatctgtggtgattga

DBGET integrated database retrieval system