KEGG   Dechloromonas aromatica: Daro_0870Help
Entry
Daro_0870         CDS       T00259                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dar  Dechloromonas aromatica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daro_0870
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daro_0870
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_0870
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daro_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
942541..943740
Genome map
AA seq 399 aa AA seqDB search
MSQYNFPDAKGHFGPYGGVFVAETLFGALDELKEAYAAAQADPAFRAEYEYELKHFVGRP
SPIYHAKRWSEMLGGAQIYLKREDLNHTGAHKVNNCIGQAMLAKRMGKPRVIAETGAGQH
GVATATVAARYGMECVVYMGSEDVKRQAANVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNIHNTFYIIGTVAGPHPYPMLVRDFQKIIGEECLVQMPEMTGRQPDAVIACVGGGS
NAMGIFYPYINVEGVRLIGVEAAGDGMETGRHSASLTAGVPGVLHGNRTYLLQDEDGQII
ETHSVSAGLDYPGVGPEHAWLKDLGRAEYQPVTDSEALAAFHTLCRIEGIIPALESSHAL
AYAAKLAPTLAKDKILLVNLSGRGDKDMHTVAEKSGIVF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatataacttcccagacgccaagggccatttcggcccctacggtggcgtcttc
gtggccgagacgctgtttggcgcgctcgatgaattgaaggaagcctacgcggctgcgcag
gctgatccggccttccgcgccgaatacgaatacgagctcaaacattttgtcggacgcccg
tcgccgatctaccacgccaagcgctggtccgaaatgctcggcggcgcccagatctaccta
aagcgcgaagaccttaaccacaccggtgcccacaaggtgaataactgcatcggccaggcc
atgctcgccaagcgcatgggcaagccgcgcgtgatcgccgaaacgggcgccggccagcac
ggcgttgcgacggccaccgtcgccgcccgctacggcatggagtgcgtggtttatatgggt
agcgaggacgtcaaacggcaggcggccaacgtctatcgcatgaaattgctcggcgccacg
gtcgtgccggtcgagtctggctctaagacactcaaggacgcgctcaacgaagcgatgcgc
gactgggtcaccaacatccacaacaccttctacatcatcggcacggtggcaggcccgcac
ccgtacccgatgctagtgcgcgattttcagaagatcattggcgaagaatgtctggtccag
atgccggaaatgaccggccgtcagccggatgccgttattgcctgcgtcggcggtggttcc
aacgcgatgggtatcttctacccgtacataaatgtcgagggcgttcgcctgattggcgtc
gaagccgccggtgatgggatggaaacgggtcgtcactctgcctcgctgactgctggtgta
cccggcgtgctgcacggaaaccgcacttacctgctgcaggatgaagatggccagattatt
gagacgcattcggtgtcggctggtctggattacccgggggttggcccggaacacgcctgg
ctgaaggacttgggtcgcgctgaataccagcctgttaccgacagcgaagcgctggccgcc
ttccataccctgtgccgtattgaggggatcatccctgcgctcgaatccagccacgcgctg
gcctacgccgccaagctggcaccgacgctggccaaggacaagattctgctggtcaacctc
tccggtcggggtgacaaggatatgcataccgtggccgaaaaatccgggatcgtcttctga

DBGET integrated database retrieval system