KEGG   Dechloromonas aromatica: Daro_0870Help
Entry
Daro_0870         CDS       T00259                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dar  Dechloromonas aromatica
Pathway
dar00260  Glycine, serine and threonine metabolism
dar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
Module
dar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daro_0870
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_0870
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daro_0870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AAZ45626
JGI: Daro0870
UniProt: Q47HQ5
Position
942541..943740
Genome map
AA seq 399 aa AA seqDB search
MSQYNFPDAKGHFGPYGGVFVAETLFGALDELKEAYAAAQADPAFRAEYEYELKHFVGRP
SPIYHAKRWSEMLGGAQIYLKREDLNHTGAHKVNNCIGQAMLAKRMGKPRVIAETGAGQH
GVATATVAARYGMECVVYMGSEDVKRQAANVYRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNIHNTFYIIGTVAGPHPYPMLVRDFQKIIGEECLVQMPEMTGRQPDAVIACVGGGS
NAMGIFYPYINVEGVRLIGVEAAGDGMETGRHSASLTAGVPGVLHGNRTYLLQDEDGQII
ETHSVSAGLDYPGVGPEHAWLKDLGRAEYQPVTDSEALAAFHTLCRIEGIIPALESSHAL
AYAAKLAPTLAKDKILLVNLSGRGDKDMHTVAEKSGIVF
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatataacttcccagacgccaagggccatttcggcccctacggtggcgtcttc
gtggccgagacgctgtttggcgcgctcgatgaattgaaggaagcctacgcggctgcgcag
gctgatccggccttccgcgccgaatacgaatacgagctcaaacattttgtcggacgcccg
tcgccgatctaccacgccaagcgctggtccgaaatgctcggcggcgcccagatctaccta
aagcgcgaagaccttaaccacaccggtgcccacaaggtgaataactgcatcggccaggcc
atgctcgccaagcgcatgggcaagccgcgcgtgatcgccgaaacgggcgccggccagcac
ggcgttgcgacggccaccgtcgccgcccgctacggcatggagtgcgtggtttatatgggt
agcgaggacgtcaaacggcaggcggccaacgtctatcgcatgaaattgctcggcgccacg
gtcgtgccggtcgagtctggctctaagacactcaaggacgcgctcaacgaagcgatgcgc
gactgggtcaccaacatccacaacaccttctacatcatcggcacggtggcaggcccgcac
ccgtacccgatgctagtgcgcgattttcagaagatcattggcgaagaatgtctggtccag
atgccggaaatgaccggccgtcagccggatgccgttattgcctgcgtcggcggtggttcc
aacgcgatgggtatcttctacccgtacataaatgtcgagggcgttcgcctgattggcgtc
gaagccgccggtgatgggatggaaacgggtcgtcactctgcctcgctgactgctggtgta
cccggcgtgctgcacggaaaccgcacttacctgctgcaggatgaagatggccagattatt
gagacgcattcggtgtcggctggtctggattacccgggggttggcccggaacacgcctgg
ctgaaggacttgggtcgcgctgaataccagcctgttaccgacagcgaagcgctggccgcc
ttccataccctgtgccgtattgaggggatcatccctgcgctcgaatccagccacgcgctg
gcctacgccgccaagctggcaccgacgctggccaaggacaagattctgctggtcaacctc
tccggtcggggtgacaaggatatgcataccgtggccgaaaaatccgggatcgtcttctga

DBGET integrated database retrieval system