KEGG   Dechloromonas aromatica: Daro_0871Help
Entry
Daro_0871         CDS       T00259                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dar  Dechloromonas aromatica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daro_0871
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daro_0871
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daro_0871
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daro_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
943740..944546
Genome map
AA seq 268 aa AA seqDB search
MSRIKSAFERLNGEGRKALIPFITAGDPDAALTLPLMHTLVEAGADVIELGVPFSDPMAD
GPTIQRASERALARGMTLRKVLQLVVEFRKTDGKTPVVLMGYANPVEAMGLEKFAAAAAQ
AGVDGVLIVDYPPEEAAAFGAAMKAQGMDPIFLLAPTSSAERIAHVAEIASGYVYYVSLA
GVTGSGALNVEAVAERLPLIREKTGLPVGVGFGIRDAATAARIAGIADAVVVGSRIIEEI
EKSTAETACANVKALVADIRRGVDEVKK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcatcaagtctgcttttgaacgcctcaatggcgaaggccgcaaggcgctgatt
cccttcattaccgccggcgacccggatgcagcgctgaccctgccgctgatgcacacgctg
gttgaagccggcgccgatgtcattgaactcggcgttccattctccgatccgatggctgat
ggtccgaccattcagcgtgcctcggaacgggcgctggccaggggcatgacgctgcgcaag
gtgctgcaactggtggtcgagttccgtaagaccgatggcaagacacccgttgtgctgatg
gggtacgctaatccggtcgaagcgatggggctggaaaagtttgccgcagcggctgctcag
gctggtgttgatggcgtgctgatcgtcgactacccgccggaagaagcggctgccttcggt
gcagccatgaaggctcagggcatggatccgattttcctgctggcaccgacttcttcggcc
gagcgcatcgcgcatgtcgccgaaattgccagcggttacgtctattacgtctcgttggca
ggggtgaccggttccggcgcactgaatgtcgaggcggtagccgagcgcctgccgctgatt
cgtgaaaaaaccggcctgccggtcggcgtcggttttggcatccgcgatgccgcgaccgca
gcacgcatcgccggtattgccgatgccgtggtcgtcggtagccggattatcgaagaaatt
gaaaaatcgacggctgaaacagcctgtgccaatgtgaaagccctggtcgcagacatacgc
cgtggtgtggatgaggtaaaaaaatga

DBGET integrated database retrieval system