KEGG   Dechloromonas aromatica: Daro_0901Help
Entry
Daro_0901         CDS       T00259                                 

Gene name
mhpB
Definition
3-(2,3-dihydroxyphenyl)propionate dioxygenase (EC:1.13.11.16)
Orthology
K05713  
2,3-dihydroxyphenylpropionate 1,2-dioxygenase [EC:1.13.11.16]
Organism
dar  Dechloromonas aromatica
Pathway
Phenylalanine metabolism
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Daro_0901 (mhpB)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Daro_0901 (mhpB)
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.16  3-carboxyethylcatechol 2,3-dioxygenase
     Daro_0901 (mhpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
975924..976862
Genome map
AA seq 312 aa AA seqDB search
MTIQLKCLSHTPLRGINDPGAATVAEVDAVLAKAKAEVEAFDPELIVVFAPDHYNGLFYD
LMPPFVIATAADSVGDYQTMTGPLSVDKDLALEMAKFILDSDIDIAISHRLQVDHGCTQT
LEEMTGSLTRYPVIPIIINSVAPPFGPYRRVRKLGEAVGKFIAKLNKRVLILGTGGLSHE
PPVPLLSGANEDIANFLIAGRNPTPEFRAARQARTLATGMIFGKPECELTPLNPEWDQNF
MDLLIRGQLDKVDAFDIEEISKAAGRSTHEVRTWVAAFAAMAASGPYNAHQDYYRPINEW
IAGYGVVSASQK
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccagctgaaatgtctgtctcacacgccgttgcgtggcatcaatgaccccggt
gccgccactgttgccgaagttgacgccgttctggccaaggcaaaggccgaagtggaggcc
ttcgatccggaactgattgtcgtcttcgcgccggatcactacaacggcctgttctacgac
ctgatgccgccgtttgtgatcgctaccgcggccgactcggtgggcgattaccagacgatg
accggtcctctgtcggtggacaaggatctggccctggaaatggccaagttcattctcgac
agtgatatcgatatcgccatttcccatcgtctgcaggtcgatcacggctgcacgcaaacg
ctggaagaaatgaccggcagcctgacccgttacccggtgattcccatcatcatcaactcg
gtggccccaccgtttggcccctatcgccgggtgcgcaagctgggtgaggcggtcggcaaa
ttcatcgccaagctgaacaagcgcgtgctgatcctcggcaccggcggcctgtcgcatgaa
ccgcccgtgccgctgctgtcgggtgccaatgaggatattgccaatttcctgattgccggg
cgcaacccgacgccggaattccgcgccgcccgccaggcccgcacgctggccaccggcatg
atcttcggcaaaccggaatgcgagctgaccccgctcaatcccgagtgggaccagaacttc
atggatctgctgattcgtggccagttggacaaggtcgatgccttcgacatcgaagaaatt
tcgaaggcagccggtcgctcgacccatgaagtccgcacctgggtcgccgcttttgccgca
atggccgccagtggcccctacaacgcccatcaggattattaccgcccgatcaacgagtgg
attgctggttacggcgtggtcagcgccagccagaagtaa

DBGET integrated database retrieval system