KEGG   Dechloromonas aromatica: Daro_0947Help
Entry
Daro_0947         CDS       T00259                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dar  Dechloromonas aromatica
Pathway
dar00010  Glycolysis / Gluconeogenesis
dar00051  Fructose and mannose metabolism
dar00562  Inositol phosphate metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
dar01230  Biosynthesis of amino acids
Module
dar_M00002  Glycolysis, core module involving three-carbon compounds
dar_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_0947
   00051 Fructose and mannose metabolism
    Daro_0947
   00562 Inositol phosphate metabolism
    Daro_0947
Enzymes [BR:dar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Daro_0947
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Daro_0947
  Exosomal proteins of bladder cancer cells
   Daro_0947
  Exosomal proteins of melanoma cells
   Daro_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AAZ45703
JGI: Daro0947
UniProt: Q47HH8
Position
1028125..1028874
Genome map
AA seq 249 aa AA seqDB search
MRKKLVAGNWKMHGSLQQNAALLELIKAGVSSLPCEVAVCPPYPYLGQVQSILSGSALAW
GAQSVSEHQSGAFTGEVAASMLLEFGCRYVLVGHSERRALYGETDTVVSAKFEAVQRAGL
VPVLCVGETLAERESGMTSVVVARQLSAVLGRVGVAAMASAVVAYEPVWAIGTGVTASPA
QAQEVHAAIRAKVAELDLGVANGLRILYGGSVKPQNAMELFGQDDIDGGLIGGAALVADD
FLAICRAAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaagctcgttgcaggtaactggaaaatgcatggcagcctccagcagaacgca
gcgctgcttgaacttatcaaggctggggtctcgagtttgccttgtgaagtcgctgtctgt
ccgccgtatccatatcttgggcaggtacagtcaattctttccgggtctgcgctggcttgg
ggggctcagtctgtaagcgagcatcagtctggtgcttttactggcgaagttgctgcttcc
atgttactggagtttggatgccgatatgtgctggtggggcattctgaacgtcgtgcgctg
tatggtgaaacggatacggtcgtttcggctaagtttgaggcggtgcagagggctggcttg
gttccggttttgtgtgtcggtgagaccctggctgagcgcgaatctggtatgacaagtgtt
gtcgtggctcgtcagttgtcggcagttctgggtcgtgttggagtcgcagccatggcttct
gcggtggttgcctatgaaccagtttgggcaatcggaaccggtgtgacagcctcgcctgct
caggcgcaggaggttcatgcggcgattcgtgccaaggttgcggaattggatcttggggtg
gcaaatggtttgcgtattttgtatggtggtagcgtcaagccacaaaatgcgatggagttg
tttgggcaggatgatatcgatggtggtttgatcggtggtgctgccttggttgcggatgat
tttctggcgatttgccgcgcggcaaattga

DBGET integrated database retrieval system