KEGG   Dechloromonas aromatica: Daro_0947Help
Entry
Daro_0947         CDS       T00259                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dar  Dechloromonas aromatica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daro_0947 (tpiA)
   01230 Biosynthesis of amino acids
    Daro_0947 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_0947 (tpiA)
   00051 Fructose and mannose metabolism
    Daro_0947 (tpiA)
   00562 Inositol phosphate metabolism
    Daro_0947 (tpiA)
Enzymes [BR:dar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Daro_0947 (tpiA)
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Daro_0947 (tpiA)
  Exosomal proteins of bladder cancer cells
   Daro_0947 (tpiA)
  Exosomal proteins of melanoma cells
   Daro_0947 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1028125..1028874
Genome map
AA seq 249 aa AA seqDB search
MRKKLVAGNWKMHGSLQQNAALLELIKAGVSSLPCEVAVCPPYPYLGQVQSILSGSALAW
GAQSVSEHQSGAFTGEVAASMLLEFGCRYVLVGHSERRALYGETDTVVSAKFEAVQRAGL
VPVLCVGETLAERESGMTSVVVARQLSAVLGRVGVAAMASAVVAYEPVWAIGTGVTASPA
QAQEVHAAIRAKVAELDLGVANGLRILYGGSVKPQNAMELFGQDDIDGGLIGGAALVADD
FLAICRAAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaagctcgttgcaggtaactggaaaatgcatggcagcctccagcagaacgca
gcgctgcttgaacttatcaaggctggggtctcgagtttgccttgtgaagtcgctgtctgt
ccgccgtatccatatcttgggcaggtacagtcaattctttccgggtctgcgctggcttgg
ggggctcagtctgtaagcgagcatcagtctggtgcttttactggcgaagttgctgcttcc
atgttactggagtttggatgccgatatgtgctggtggggcattctgaacgtcgtgcgctg
tatggtgaaacggatacggtcgtttcggctaagtttgaggcggtgcagagggctggcttg
gttccggttttgtgtgtcggtgagaccctggctgagcgcgaatctggtatgacaagtgtt
gtcgtggctcgtcagttgtcggcagttctgggtcgtgttggagtcgcagccatggcttct
gcggtggttgcctatgaaccagtttgggcaatcggaaccggtgtgacagcctcgcctgct
caggcgcaggaggttcatgcggcgattcgtgccaaggttgcggaattggatcttggggtg
gcaaatggtttgcgtattttgtatggtggtagcgtcaagccacaaaatgcgatggagttg
tttgggcaggatgatatcgatggtggtttgatcggtggtgctgccttggttgcggatgat
tttctggcgatttgccgcgcggcaaattga

DBGET integrated database retrieval system