KEGG   Dechloromonas aromatica: Daro_1174Help
Entry
Daro_1174         CDS       T00259                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dar  Dechloromonas aromatica
Brite
Enzymes [BR:dar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Daro_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1279026..1279844)
Genome map
AA seq 272 aa AA seqDB search
MQVQPTSSLPLALFHGLLSSPQEFGLITHWLRNNGVTHLAPTVPGYTLAVDEQSPDWRKW
QSAAVDIVDTFGNGDEPIILGGLCMGGVLAAAAALKTRRKIAGLILMSPTFDYDGWGLSP
TRHLRHFGYWTGLDRFFSVTEREPYGVKSPKIRKWVIREMAERASSAVGPSRIPLRALRE
GERMMAHVRAHLADIDCPVLIMHAREDEITTLASVQRLFDALPQHDKELAVLENSYHMIT
IDNDRHEVSRLVERFMKRVSTEYLASNFPVAA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtgcaaccgacctcttcccttcccttggcgttgtttcacggccttctttcctcc
ccgcaggaatttggcctgatcacccattggttgcgaaacaacggcgtgacccaccttgca
ccgaccgtcccgggctacacgctggcggtcgatgagcaatcgcccgattggcgaaagtgg
cagagtgcggcggtagatatcgttgacaccttcggcaacggcgacgaaccgatcatcctg
ggtggcttgtgcatgggcggtgtccttgccgccgccgcagcactgaaaacccgtcgcaaa
atcgctggcctgatcctgatgtcgccaacgtttgactacgatggctggggcttgtctccg
actcgccatttgcgtcactttggctattggacgggactggaccgcttcttttcggtgacc
gaacgcgagccctatggcgtcaagagcccgaaaattcgtaaatgggtgattcgcgaaatg
gccgaacgcgccagctcggccgtcggtccgtcgcgcattccgctgcgggccttgcgtgaa
ggtgagcgaatgatggcccatgtgcgcgcccatctggccgacatcgattgccccgtgctg
atcatgcacgccagagaagatgaaatcaccacgctggccagcgtgcagcgattgtttgat
gcgctcccccagcacgacaaggaacttgcagtgcttgaaaacagctaccacatgatcacg
atcgacaatgatcgtcacgaggtttccagactcgtggaacgcttcatgaaaagggttagc
accgaatacctagcttcgaatttccctgtcgctgcctga

DBGET integrated database retrieval system