KEGG   Dechloromonas aromatica: Daro_1275Help
Entry
Daro_1275         CDS       T00259                                 

Definition
(GenBank) Asparagine synthase, glutamine-hydrolyzing
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
dar  Dechloromonas aromatica
Pathway
dar00250  Alanine, aspartate and glutamate metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Daro_1275
Enzymes [BR:dar01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Daro_1275
Peptidases [BR:dar01002]
 Cysteine Peptidases
  Family C44
   Daro_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AAZ46027
JGI: Daro1275
UniProt: Q47GK4
Position
1383398..1385350
Genome map
AA seq 650 aa AA seqDB search
MCGVIGFIRTDFSRTYAADSRRQLELMADAVVHRGPDDAGYWGDESHGIWLGHRRLSILD
LSPAGHQPMSSACGRYIVVFNGEVYNWASIRTELEQSGRAPVWRGHSDTEVLLAGLVAWG
LEATLKRARGMFAIAVWDRQQRVLSLARDRIGEKPLYYGRVGDTFVFASELKSLRAIPGA
DFQTDPGSLALMLRYGYVPAPLCIYRNIFKLPPGTLLRVNARGEFGEPEAWWSFAETAQQ
RVAGRSPMSDAAALDALDEVLGAAIGEQMVADVPLGALLSGGLDSSMVVALMQARSTKPV
RTFTIGFAEGAYDEAAHAKVVAAHLGTEHTELYVSPDQARAIIPSLPDMYDEPFADSSQI
PTALVCALTRQHVTVCLSGDAGDELFGGYNRYFWATSLWRRFGKMPLGLRKGAAGIFSSV
SAGTWNSAFGALSWAMPGRLRVSNPGDKLHKLAEVMAAESEEALYRELVSQWRGPLPMRS
PNEPRTLVPDPARWPRMPSYAERMMAVDTLTYLPDDILVKVDRAAMAASLETRVPFLDER
VISFAWGLPFEQKVRNGQGKWLLRQLLYRYVPQAMVDRPKQGFGVPIEHWLRGPLRDWAE
DLLSPDQLASDGLLDPTPIRAMWEKHLSGRNVQYALWNVLMYQAWRRRWA
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtgatcggttttatccgcactgatttttccaggacttacgccgcggattca
aggcgccagcttgaactcatggctgatgcagttgttcaccgtggccccgacgatgccgga
tattggggggatgagagccacggcatatggttggggcatcggcggctttcgatccttgat
ttgtcccctgctggtcatcagccgatgtcttctgcctgtggtcgctatatcgtcgttttc
aacggcgaggtttacaactgggcgagcatccgtacggaactggagcagtctggacgtgcc
ccagtgtggcgtggccattccgataccgaggttctgttggctggactcgtggcctggggg
ctggaagcgaccttgaaacgtgcacgcgggatgttcgccatcgccgtttgggatcgtcag
cagcgggtgctttcgctcgctcgcgaccgtatcggcgagaagcctttgtattacggccgg
gtcggcgatacttttgtctttgcctcggaattgaaatcgctaagggcgattccgggggcg
gattttcagaccgacccgggttcgctggccctgatgttgcgctatggctacgtgccggcg
ccgttgtgcatttaccggaatattttcaagttgccaccgggcaccctgctgcgcgtcaat
gcccggggtgagttcggcgagcccgaggcctggtggtctttcgccgagaccgcacagcag
cgtgtcgccggtcgttcgccgatgtccgacgcagcggccctggatgccctcgacgaggtg
ctgggtgcagccattggcgagcagatggtggccgatgtgcctttgggggcgttgctctcc
ggcgggctcgactcctcgatggttgttgccttgatgcaggcgagaagcaccaagccggtt
cgcactttcacgatcggtttcgccgagggcgcgtacgacgaggcggcacatgccaaggtc
gttgccgcccatctgggcacggagcacactgagctttacgtgtcgccggatcaggcacgc
gccatcatcccgagtttgcctgacatgtacgacgagccgtttgcggattcgtcgcagatc
ccgacggccctcgtttgtgcgctgacccgccagcacgtcacggtttgcctctccggcgat
gccggcgacgagttgtttggcggttacaaccgctatttctgggcgacttccctgtggcgg
cgtttcggaaaaatgccgctcggactgcggaaaggggcggccgggattttctcctccgtt
tctgccgggacatggaacagcgcctttggcgcattgtcgtgggcgatgcccgggcggctc
cgggtcagcaaccccggagacaagctgcacaagctggctgaagtcatggccgcggagtcg
gaggaggctctctatcgcgaactggtcagccagtggcggggtcccctgccgatgcgctcg
ccaaacgagccgagaaccttggtgcccgatccggcgcgctggcctcgtatgccgtcgtat
gccgagcggatgatggcggtcgatacactgacctatttgccggacgacatcctggtcaag
gttgatcgggcggcgatggcggccagccttgaaacccgcgttccctttctggacgaacgg
gtgatttcctttgcgtggggcctgcctttcgagcagaaagtccgcaatggccaaggcaag
tggttgctcaggcagttgctgtaccgctatgtaccgcaagccatggtcgatcgtccgaag
cagggcttcggcgttcccatcgagcattggctgcgcgggccgctgcgcgattgggcagaa
gacctgttgtcgccggatcagttggcctcggatggtttgctcgacccgacaccgattcgg
gcgatgtgggaaaaacacctgtcgggacgaaatgtgcaatatgcgttgtggaatgtgctg
atgtaccaggcttggagaagacgatgggcttga

DBGET integrated database retrieval system