KEGG   Dechloromonas aromatica: Daro_1571Help
Entry
Daro_1571         CDS       T00259                                 

Definition
cytochrome c oxidase, subunit II
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
dar  Dechloromonas aromatica
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Module
Denitrification, nitrate => nitrogen
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:dar00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1683331..1685613)
Genome map
AA seq 760 aa AA seqDB search
MKKFVVKTTAVLLAAGFAATAWSAESLQDVMKRRGLSQQDLLAASKTYVPTGKRDEFVAF
SSGGQSGQIIVYGIPSMRILKYIGVFTPEPWQGYGFDEESKAVLRQGNIDGKEINWGDTH
HPAMSETQGKYDGQFLFINDKANPRLAVIDLRDFETKQIVVNPIFKSEHGGAFVTQDTDY
VIEAAQYASPLENKKFFPLEEFNEKYRGGVTYWKFDRKEGRIDPKKSFSLELPPYSQDLS
DAGKGPSDGWSFTNSFCSERYVGGIEKGRPPYEAGCSAKDTDYLHVINWKKAAELVAQGK
AKKINGHDVIMMETAIKEGILFLVPEPKSPHGVDVTPDGKFLTVAGKLDTHVSVYSFEKI
QAAIKAGKFESKDPYGIPVIGMKDALHTQVQLGLGPLHTQYDSKPCIAYTSLYVDSQVVK
WNHCEGKVLDKISVHYNIGHLMTMEGDSADPKGRYLVALNKLSIDRFTPVGPLHPQNHQL
IDISNDKMQLLYDMPVPLGEPHYVVAIEASKLKPGVRYKVGTNSRTDKPSPFGVRAGEEH
TDKKGNKIEVFGTLIRSHITPETIEAEVGDEVTVHLTNLERAQDETHGFTVSTFNTHASV
EPGKTVTVKFKADKEGVYPYYCTEFCSALHLEMQGYLLVKPKGWKPGKTAEAKASYTEAD
YKATVKKVADTQVVIDSVVGFITSVNYKDFPDVVAMVEDATDQLNKMKDAKAKHEAAAAK
KDWDQANLWAEQVWQYQVKAADIGLRAKTYLEQNGAKKVK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaatttgtagttaagacgaccgcggttttgctggcagcgggttttgccgccacg
gcatggtctgccgaatcgctgcaggacgtgatgaagcgtcgcggtctcagccagcaggat
ctgctcgctgcctccaagacctatgtcccgaccggcaagcgtgacgagttcgtcgccttc
agttctggcggccagtccggccagatcatcgtgtacggtattccgtccatgcgcatcctg
aagtacatcggcgtcttcacgccggaaccttggcaaggctacggctttgacgaagaatcc
aaggctgtgctgcgtcagggcaacatcgacggcaaggaaatcaactggggcgatacgcac
cacccggccatgtccgaaacccagggcaagtatgacggtcagttcctcttcatcaacgac
aaggccaatccgcgcctcgccgtgatcgacctgcgtgacttcgaaaccaagcagatcgtg
gtcaacccgatcttcaagtccgaacacggtggcgccttcgtcacccaggatacggactac
gtcatcgaagctgcccagtacgcctcgccgctcgagaacaagaagttcttcccgctcgaa
gagttcaacgaaaagtatcgcggtggtgtgacctactggaagttcgaccgcaaggaaggc
cgcatcgatccgaagaagtcgttctccctcgaactgccgccgtacagccaggacttgtct
gacgcgggtaaaggcccgtccgacggttggtccttcaccaattccttctgttccgagcgt
tacgttggcggcatcgaaaaaggccgtccgccgtatgaagccggttgctctgccaaggac
accgactatctgcacgtgatcaactggaagaaggctgctgaactggttgcccagggcaag
gccaagaagatcaacggccacgacgtgatcatgatggaaaccgcgatcaaggaaggcatc
ctcttcctggttccggaaccgaagtcgccgcacggcgtcgacgtcacgccggacggcaag
ttcctgaccgttgccggcaaactcgacacccacgtctccgtctattccttcgagaagatt
caggccgccatcaaggccggcaagttcgaatccaaggatccgtacggtattccggtcatc
ggcatgaaggatgcactgcacacccaggttcagctcggccttggcccattgcatacccag
tatgactccaagccgtgtatcgcctacacctcgctttacgtcgactcccaagtcgtcaag
tggaatcactgtgaaggcaaggtcctcgacaagatctcggtgcactacaacatcggtcac
ctgatgaccatggaaggcgactcggctgatccgaagggccgttacctggtggcgctgaac
aagctctccatcgaccgcttcacgccggttggtccgctgcatccgcagaaccaccagttg
atcgacatcagcaacgacaagatgcaactcctgtacgacatgcccgtaccgctgggtgag
ccgcactacgtggtggccatcgaagcctcgaagctgaaaccaggcgttcgctacaaggtc
ggcaccaacagccgtaccgacaagccgagcccgttcggtgttcgcgccggtgaagagcac
accgacaagaagggtaacaagatcgaagtctttggcaccctgatccgttcgcacatcacg
ccggaaaccatcgaagccgaagtcggcgacgaagtgacggtccacctgactaacctggaa
cgcgctcaggacgaaacccacggctttaccgtgtcgacgttcaacacccacgcttcagtt
gagccgggcaagacggtgaccgtcaagttcaaggcggacaaggaaggcgtctatccgtac
tactgcacggaattctgctccgcactgcaccttgaaatgcagggttacctgctggtcaag
ccgaagggctggaagccgggcaagacggccgaagccaaggccagctacacggaagccgac
tataaggcgacggtgaagaaggtggctgatacccaggtcgttattgattccgtggtgggt
ttcatcaccagcgtgaattacaaggacttcccggatgtcgtggccatggtcgaagatgca
accgaccagttgaacaagatgaaggatgccaaggccaagcacgaagccgcagccgccaag
aaggattgggaccaggccaacctgtgggctgagcaagtctggcaataccaggtcaaggca
gctgacatcggcctgcgtgccaagacctacctcgaacagaacggcgccaagaaggtcaag
taa

DBGET integrated database retrieval system