KEGG   Dechloromonas aromatica: Daro_1735Help
Entry
Daro_1735         CDS       T00259                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dar  Dechloromonas aromatica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Daro_1735
   00052 Galactose metabolism
    Daro_1735
   00500 Starch and sucrose metabolism
    Daro_1735
   00520 Amino sugar and nucleotide sugar metabolism
    Daro_1735
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Daro_1735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1866131..1867000
Genome map
AA seq 289 aa AA seqDB search
MKKVRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQFAVEEAVAAGITDMVFVTGRS
KRSIEDHFDKAYELESELQARGKDELLDFVRNMIPKNINCIYIRQAEALGLGHAVLCAKP
VIGDEPFAVILADDLLDGKPAVMKQMTDTYDYYRCSVLGVQDVPRADTRSYGIVDARPVA
ERVEQVNAIVEKPKPEDAPSTLAVVGRYILTPRIFHHLENVKPGAGGEIQLTDGIASLLS
EEQVLAYRYHGTRYDCGSKLGYLQATVVFGQRHPEVGPAFDAYLKTLGG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggttcgcaaggcagtgtttcctgtcgccgggatgggcacccgtttcttgccg
gccaccaaggccagcccgaaggaaatgctccctatcgtcgacaagccgttgatccagttt
gccgttgaggaagcggtggcggccggcatcaccgacatggtgttcgtgaccggtcgctcc
aagcgttccatcgaggaccatttcgacaaggcctatgaactggaaagcgagttgcaggcg
cgcggcaaggacgagttgctcgatttcgtccgcaacatgattccgaagaacatcaactgc
atctatatccgccaggctgaagcgcttggcctcggccacgccgttctatgtgccaagccg
gtgatcggcgacgagccttttgccgtgatccttgccgacgacctgctcgacggcaagcca
gccgtcatgaagcagatgaccgacacctacgactactaccgctgttccgtgcttggcgtg
caggatgtgccgcgggccgatacccggagctacggcatcgttgatgcccgtccggtggca
gagcgggtagagcaggtcaacgccattgtcgagaagccgaaaccggaagacgcgccgtcg
acgctggctgtcgtcggccgctacatcctgacgccacgcatcttccatcatctggaaaac
gtcaagccgggcgccggcggcgaaatccagttgaccgatggcatcgcctcgctgctcagc
gaagagcaggtgctggcctatcgctaccacggcacgcgctacgactgcggctccaagctt
ggctaccttcaggcaacggtggttttcggccagcgccacccggaggtcgggccggctttc
gatgcctatctgaagaccctgggaggctga

DBGET integrated database retrieval system