KEGG   Dechloromonas aromatica: Daro_1774Help
Entry
Daro_1774         CDS       T00259                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dar  Dechloromonas aromatica
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Daro_1774
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Daro_1774
Enzymes [BR:dar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Daro_1774
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1912135..1913463
Genome map
AA seq 442 aa AA seqDB search
MVAGNLVHKLRSLMGGSAERVALTARGVEQLRAQLRECADGQGGEVSARARAARLAETYL
GLNDAGRHRFLKLIALEFGPDPAKVATAHAAYQKAVGTPEQWKAEAAMRGAMRSSRIRIL
TQFNAIPQGVKFLVDLRADLLRYLENDRELAVLDRELESRLSAWFDVGFLELQRITWNSP
AALLEKLIEYEAVHEIRSWTDLKNRLDSDRRLYAFFHPRMPAEPLIFVEVALTDHLADNV
QALLDEHAPVFDNRKADTAIFYSISNTQVGLRGVSFGNFLLKRVIDDLKRDFPKLANFAT
LSPMPAMAAWLRKNPQALTDAGVELPLEELSMGTWAADKKLVRSLRDPLSRLGARYLASA
KQGGGEAGAPFDPVSRFHLGNGARVERINYLGDSSAKGFRQSFGLMVNYLYSPDDIETNL
EAFASQGSIAMSATVRRLAKRL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggtggcaggaaatctggttcacaagctgcgttccctgatgggcggcagcgccgagcgc
gtggccttgacggcacgtggtgtcgagcagttgcgcgcccagttgcgcgaatgtgctgac
gggcagggcggcgaggtctcggcccgtgctcgggcggcacggctggccgagacttatctc
ggcctcaatgacgcggggcggcaccgcttcctcaagttgatcgcgctggagttcgggccc
gatccggccaaggtggcgacggcgcatgcggcttatcagaaggctgttggcacgccggag
caatggaaggcggaagcggcgatgcggggcgccatgcgctcgtcgcgcatccgtatcctg
acccagttcaatgccattccacagggcgtgaagtttctcgttgatctgcgcgccgacctg
ttgcgctatcttgaaaacgaccgggagctggcggtacttgaccgcgagctggagtcgcgg
ctctcggcctggttcgatgttggctttctcgaattgcagcgcatcacctggaattccccg
gccgccttgctggaaaagctgatcgagtacgaggcggtgcacgaaatccgctcgtggacc
gacctgaagaaccggcttgattcggaccgccgcctgtacgccttcttccatccacgcatg
ccggctgagccgctgatctttgtcgaggtggcgctgaccgaccatctggccgataacgtt
caggcgctgctcgacgagcacgcgccggttttcgacaaccgcaaggccgatacggcgatt
ttctattcgatctcgaacacgcaggtgggtttgcgtggtgtttcgttcggcaacttcctg
ttgaaacgcgtgatcgatgacctgaaacgcgattttccgaagctggccaatttcgccacg
ctgtcgccgatgcctgcaatggctgcctggttgcgcaagaacccgcaggcgctgacggat
gcgggcgtcgagttgcctctggaagagctttccatgggcacctgggcggcggacaagaaa
ctcgttcgctccctgcgcgatccgctgagccgtcttggtgcccgatatctggccagtgcc
aagcagggtggcggtgaagccggggcgccattcgacccggtgtcgcgcttccatctgggc
aatggcgcgcgggtcgagcgcatcaactaccttggcgacagttcggccaagggcttccgg
cagtcattcggattgatggtgaattacctatacagcccggatgacatagaaaccaatctg
gaggccttcgccagccaggggagtatagcgatgtcggcgacggtgcggcgattggcgaag
cggctgtaa

DBGET integrated database retrieval system