KEGG   Dechloromonas aromatica: Daro_1922Help
Entry
Daro_1922         CDS       T00259                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dar  Dechloromonas aromatica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Daro_1922
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Daro_1922
Exosome [BR:dar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Daro_1922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2066879..2068387)
Genome map
AA seq 502 aa AA seqDB search
MQDRSDQFVLALDQGTTSTRAILFGRKGDIHGVAQQEITQHYPQPGWVEHDAEEIWQAQL
AVARAALRDNGILAKQIVAVGMTNQRETTVLWDRSSGEPLHRAIVWQDRRTAGLCDELTT
AGHAGLFRERTGLVLDAYFSGTKLKWLLDHIPGARSRAERGELAFGTIDSWLTWKLSGGR
AHVTDPSNASRTLLFDIHRCCWDEELLALLDIPMALLPRIVDSSGEIATIAAEWLGAEIP
LSGIAGDQQAATFGQVCLQHGMAKNTYGTGCFLLMNTGQAPMASCHRLLTTIGWQRQGKT
TYLLEGSVFMGGATVQWLRDGLGLISSADQIESLAASVADNGGVYLVPAHTGLGAPYWDP
FARGALFGMTRGTTRAHIARAALEAIAFQSADVLQAMEKDAGQSLSELRVDGGAARNDLL
MQFQADLLGVPVVRPQVTETTALGAAYLAGLAVGFWQDEAELTALWRADRRFEPSMAEDR
RSALFADWHRAVERSLHWANAT
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatcgttccgaccagttcgttctcgcgcttgaccagggaacgaccagcacacgc
gccatcctgttcgggcggaagggcgatattcatggcgtcgcccagcaggaaatcacccag
cattacccgcaacccgggtgggtcgagcacgacgctgaagaaatatggcaggcgcagctt
gccgtggcgcgagcggcactccgcgataacggcatattggccaagcagatcgtcgctgtc
ggcatgaccaaccagcgggaaacgacggtgctttgggatcgatccagcggtgaaccgctg
caccgcgctatcgtctggcaggatagacgcaccgccgggctttgcgacgaattgacaacg
gccggccacgccgggctgttccgcgaacgcactggtctcgtactcgatgcctatttttcc
ggcaccaagttaaagtggctgctcgaccacattcccggcgctcgctcccgggccgagcgt
ggcgaactggctttcggcaccatcgacagctggctgacctggaaactctccggcgggcgc
gcccatgtcaccgacccgtcgaatgcctcgcgcaccctgctcttcgacatccaccgctgc
tgctgggatgaggaattactggccttgctcgacattccgatggcgctgctgccgcgcatc
gtcgacagcagcggcgaaatcgccaccatcgccgccgaatggctgggcgccgagatcccg
ctcagtggcatcgctggcgaccagcaggcggccactttcggccaggtctgtctccagcat
ggcatggccaagaacacctacgggactggctgcttcttgctgatgaataccggccaagcc
cccatggcgtcctgccaccggctactgaccaccatcggctggcagcggcaagggaagacc
acttacctgctcgaaggcagcgtcttcatgggcggtgccacagtacagtggttgcgcgac
ggcctcgggctgatctccagcgcggaccagatcgagtcgctggcagcgagcgtcgcggat
aacggcggtgtctacctggtgccggcccacaccggcctcggcgcgccatactgggacccg
ttcgcccgaggcgccttgttcggcatgactcgcggcaccacccgcgcccacatcgcccgt
gccgcgctggaagccatcgcattccagagtgccgatgtgctgcaggccatggaaaaggat
gccggtcaaagcctgagcgaacttcgcgtcgacggcggtgcggcacgaaacgacctgctg
atgcagtttcaggcagatttgctcggcgtgcccgtggtgcggccgcaggtgaccgaaacc
acggcgcttggtgccgcctatctggctggactggccgtgggtttctggcaagacgaggcc
gagctgacggcactgtggcgggccgaccggcgctttgagccgtccatggccgaggaccgg
cgcagtgcgctgttcgccgactggcaccgcgccgtcgaacgcagcctgcattgggcaaac
gcgacatga

DBGET integrated database retrieval system