KEGG   Dechloromonas aromatica: Daro_2034Help
Entry
Daro_2034         CDS       T00259                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dar  Dechloromonas aromatica
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Daro_2034
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Daro_2034
Enzymes [BR:dar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Daro_2034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2184790..2185809
Genome map
AA seq 339 aa AA seqDB search
MMHLPLGPLMIDITGTELTDLDRERLCHSLVGGIILFSRNYANQDQLLELCSAIHTLRSP
SLLIAVDHEGGRVQRFRDGFTRLPPMATLGKLWDRDPQAALVATRQTGYVLAAELRARGV
DYSFTPVLDLDYGPSRVIGDRAFHRQPDAVIALAAALGEGLRQAGMGSCGKHYPGHGYVI
PDSHVELPVDDRAFEAMQEDIAPYRNLPLDGVMAAHVIYNCMDCNTAVFSNKWISYLRND
IKFNGAVFTDDLSMAGAGVVGGMLSRVETAYAAGCDMLLVCNAPDVVGDVLENWKPEIDL
RRGKRVEALIPKTPAVPWQVLQADPAYQAAQKTIAELMA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatgcatttaccgctcggcccgctgatgatcgacattactggcaccgaactgacagat
cttgatcgcgaacgcctttgccattcattggttggtgggatcatcctgttttctcgaaac
tatgccaaccaggatcaattgctagaactctgttcggcaatccataccttgcgctcgcca
tcgctgctgattgccgttgatcacgaggggggcagggttcagcgttttcgcgacggtttt
acccgtctgccacccatggccacgttggggaaactttgggatagggatccgcaggcggca
cttgtcgccacccgccagactggctacgtgctggccgccgaacttcgcgcccgtggcgtc
gattattcctttacaccggtgcttgatctcgattatggcccctcacgcgtcatcggcgat
cgtgctttccaccgccaaccggacgcggtaatcgcgctcgccgctgcgctaggtgaaggt
ctgcgccaggcaggcatgggcagttgtggcaagcattatccgggacacggttatgtcatc
cccgattcgcatgtcgaactgccggtcgatgatcgtgctttcgaagcaatgcaggaagat
atcgctccctaccggaatcttccgctggatggcgtgatggctgcccatgtgatttacaac
tgcatggactgcaatacggctgtattttcaaataaatggataagttatttgagaaatgac
attaaatttaacggggcggttttcaccgacgatttatcgatggccggcgccggtgtggtc
ggcggcatgctgtctcgggtcgagacagcttacgcagccggctgcgacatgctgctcgtg
tgtaatgcccctgatgttgtcggcgatgtgctggaaaactggaagccggaaatcgatttg
cggcgcggcaaacgggtcgaggcgctgatccccaagacgcccgccgtgccttggcaagtg
cttcaggcagacccggcttatcaggcggcccaaaagaccatcgccgaattgatggcctga

DBGET integrated database retrieval system