KEGG   Dechloromonas aromatica: Daro_2045Help
Entry
Daro_2045         CDS       T00259                                 

Definition
(GenBank) CheB methylesterase:MCP methyltransferase, CheR-type
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
dar  Dechloromonas aromatica
Pathway
dar02020  Two-component system
dar02030  Bacterial chemotaxis
Module
dar_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:dar00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daro_2045
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Daro_2045
Enzymes [BR:dar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Daro_2045
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Daro_2045
Two-component system [BR:dar02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Daro_2045
Bacterial motility proteins [BR:dar02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Daro_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_10 CheR_N IncA PAS_4 Golgin_A5 ATG16 Rootletin Fez1 Spc7 Methyltransf_12 HemX CENP-F_leu_zip APG17 DUF3584 DUF4795 WEMBL MAD TPR_MLP1_2 IL12 ZnuA Leu_zip IFT57 OmpH Fmp27_WPPW HMMR_N Lebercilin Exonuc_VII_L Mnd1 ADIP KASH_CCD Mod_r APG6 LMBR1 Snapin_Pallidin Seryl_tRNA_N AAA_13 TBPIP HOOK HIP1_clath_bdg HAUS-augmin3 GAS DUF812 RasGAP_C Reo_sigmaC DUF4407 DUF3450 PAS_9 Phage_GPO TMPIT Filament DUF2529 DUF3552 DUF4472 Prominin Atg14 Laminin_II Occludin_ELL V_ATPase_I Cob_adeno_trans Tho2 FapA FliJ Sec34 zf-C4H2 Jnk-SapK_ap_N DASH_Duo1
Motif
Other DBs
NCBI-ProteinID: AAZ46790
JGI: Daro2045
UniProt: Q47EE1
Position
2196552..2199158
Genome map
AA seq 868 aa AA seqDB search
MPSQGKHEQALLPSSALAEDKYFPIVGIGTSAGGLEALEQFLGGVPVNCGMAFVVVQHLD
PNRYGMLPELLQRSTPMVVKQAGNRMKIKPDCVYVIPPNKDLSILHDTLYLLDPVAARGL
RLPINSFLCSLAEDRRERAIGIILSGMGSDGTQGLLAISEHGGLSVVQDPTTAKFDAMPR
SAIDARLADIVAPPGDLARRIIDRLHHPPRLLPPETFLVPDSEAKSSAFEKICILLRAQT
GHDFSLYKKSTIYRRVERRMGIHRLGGIADYVGFLQTNPQEVDLLFKELLIGVTSFFRDP
AAWAYLQEQVLPGMILAKTHDNLLRAWVAGCSSGEEAYTLAMIFGEAMDHAKPTNRIELQ
IFATDLDPDAIAKARQGIYPSSIAGDVSPERLARFFVEENGRFRICQEIRQMVVFAPHNV
TMDPPFTRLDILTCRNVLIYLGADLQKRLLPLFHYSLKPGGTLFLGSAESIGNFAELFSP
LEPKARIYRREEVNQRAIDVDFPTRYLGDSPNPALIPSPTMQPANLQTLADQLLLQKFSP
AAVLTNADGDILFISGRTGKYLEPAAGKANWNIHAMAHEGLRQELILALPKALRIGEAVV
VKDLTIEDGSERQSLDLTVYPIDEPAPLHGMAMIVFADVVAAKPAPKRHSRKQLVDARVA
ELEQALLQAREELQSIREEMQTSHEELKSANEELQSTNEELQSTNEELTTSKEEMQSLNE
ELQTVNAELQSKVDEWSATSNDMKNLLNSTDIATVFLDNMLHVRRFTRQATHIFKFIPSD
IGRPLADIVHKLDYTDLQDDAQEVLRTLAFCEKQITSNDGCWYIVRIMPYRTLENVIDGV
VITFIDISEAKRLEAELRAARTALPGNR
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcaaggaaagcacgagcaagccctgctaccctcctccgcattagctgaggac
aagtactttccgatcgtcggcataggtacgtcagccggaggattggaagcactcgagcag
tttttgggcggtgtgccggtcaattgcggcatggcttttgtcgtcgtccagcacctcgac
cccaatcgctacggcatgcttccggagctcttgcaacggtccaccccgatggtggtcaag
caggcaggaaaccggatgaagatcaagccggattgtgtctatgtgatcccacccaacaag
gatctgtcgatcctccacgacacgctctacctgctcgatccggtagcggcaagaggatta
cgtctgccgatcaactcctttctctgtagcttggccgaagaccggcgcgaacgagccatc
ggcatcatcctttccggcatgggatcagatggaacccagggcctgctggcgatcagcgaa
catggtggcctgtcggttgtacaagaccctactacggccaagttcgatgccatgccacgc
agcgcaattgatgcccggctggcggatatcgttgccccgccgggcgatctagccagacgg
attattgatcgtctgcaccacccgcctcgccttttgccccccgaaacctttcttgtgccg
gatagcgaggccaagagctcggccttcgagaagatctgcatcctgctgcgagcccagacc
ggccacgatttttcgctgtacaagaaaagcacgatctatcggcgcgtcgagcgccgcatg
ggcattcatcgtctgggcggaatcgccgactacgtcggttttctccagaccaacccgcag
gaagtcgacctgctcttcaaggaattgctgatcggcgtcaccagcttcttccgcgacccc
gcggcctgggcctacctgcaggaacaagtgctacccgggatgattctcgccaaaacgcac
gacaacctgctgcgcgcctgggtggccggctgctcgagtggcgaggaagcctacacgctg
gccatgattttcggcgaagcgatggaccatgccaaacccaccaaccggatcgagctgcaa
attttcgccaccgacctcgatccggatgccattgccaaggcaagacagggaatctatcca
tccagtattgccggcgacgtttccccggagcggctggcgcggttttttgttgaagaaaat
ggccggtttcggatctgccaggaaatccgccagatggtggtgttcgcaccgcacaatgtc
acgatggacccgccttttacccggctggatatcctgacctgtcggaacgtgctgatttat
ctgggcgccgacctgcaaaagcgcttgttgcccctctttcactacagcctgaaacccggt
ggcacgctttttctgggttcggccgaaagcatcggcaactttgccgagctgttttccccg
ctggagcccaaggcgcgaatctatcgccgggaagaagttaaccaacgagcaatcgatgtc
gatttcccgacccgctatttaggcgactcccccaaccctgccctgataccgtcaccgacc
atgcaacctgccaacctgcaaaccctggccgaccaactgctgctgcagaaattctcgccg
gccgccgtgttgaccaatgcggatggggacatccttttcatcagcgggcggaccggaaaa
tacctggagccggcggctggcaaggccaactggaacattcatgcgatggcccacgaaggc
ttgcgtcaggagctgattctcgccctgcccaaagcactgcgtatcggcgaggccgtcgtc
gtcaaagacctgacgattgaggatggcagcgaacgccagagccttgacctgaccgtttat
cccatcgacgaacccgcacccctccacggcatggcaatgatcgtttttgccgatgttgtc
gcggcaaaaccagcgcccaaacgccattcgcggaagcagcttgtcgatgcccgggtcgcc
gaactggagcaggccctgctccaggcaagggaagagcttcagagcattcgggaggaaatg
cagacctcgcacgaagaactcaaatcggccaacgaagagttgcaatcgaccaatgaagag
ctgcagtcgaccaacgaggagctgaccacttccaaggaggaaatgcagtctctcaacgaa
gagttgcagacggtcaatgccgaactccagtcaaaagtcgatgaatggtcggcgaccagc
aacgacatgaagaacctgctgaacagcaccgacatcgccacggtttttctcgacaacatg
ctgcatgtgcggcgttttacccgccaggcgacacacatattcaagttcattccgagcgac
atcggacggccgctggccgatatcgtccataagctcgactacaccgatttgcaggacgat
gcccaagaggtcttgcgaacgctggccttctgtgaaaaacagatcaccagcaacgacgga
tgctggtacatcgttcggatcatgccctaccggacgctcgaaaacgtgatcgacggcgtg
gtgatcacgttcatcgacatcagcgaggcgaaacgcctcgaagccgaactccgggccgcc
agaactgccctaccgggaaaccgataa

DBGET integrated database retrieval system