KEGG   Dechloromonas aromatica: Daro_2126Help
Entry
Daro_2126         CDS       T00259                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
dar  Dechloromonas aromatica
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Daro_2126
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daro_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2296513..2296935
Genome map
AA seq 140 aa AA seqDB search
MKCRTPRPGLLAILLSLALSPVHAGDSPADAHARGAIIYERCAACHALQTDRTGPRHCGL
IGRRAGSVPGFAYSPAMRQSRLIWSEANLDRFIKAPMAFMPGTAMGYDGVKNDAERHDLL
AFLRQEGISDKCRNLQVERP
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgccggacgcccaggccgggcctcctcgccatcctgctgtcactggccctgtca
ccggtccatgccggtgacagcccggccgatgcccatgcacgtggtgccatcatttacgaa
cgctgcgctgcctgccatgccttgcagaccgaccgtaccggaccacgccactgcggcctg
atcgggcgccgtgccggcagcgtgcccggttttgcctactcgccggccatgcgccagtca
cgccttatctggagcgaagccaatctcgatcgcttcatcaaggcgccaatggccttcatg
cctggaactgccatgggctacgacggcgtcaagaacgatgctgagcggcacgacctgctg
gccttcctgcgccaggagggaatcagtgataaatgccggaaccttcaggtggagcgacca
tga

DBGET integrated database retrieval system