KEGG   Dechloromonas aromatica: Daro_2318Help
Entry
Daro_2318         CDS       T00259                                 

Definition
periplasmic thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dar  Dechloromonas aromatica
Brite
Enzymes [BR:dar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Daro_2318
Secretion system [BR:dar02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Daro_2318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2498580..2499398
Genome map
AA seq 272 aa AA seqDB search
MATTKPMRRRALVAALSTILLGACFAANAAKPDETQLLTALQKAHPGTQFSSVARTPIAG
LYEVWMNGNVAYVSARQPRYFLFGHLFDTQSMSDLTDPKMAQAGKAKSPDEAPQKYQPTT
ASPIRFEQLPLSNAIKTVHGTGQRRMAVFSDPNCPFCKQLETELASLDNLTIYTFLLPFL
GETKPIAIWCAADRAAAWQRLMLDGDDSLLNTGAACDHPIGRNLALARQLGVQGTPTLIW
ADGTRSEGFVGQTVIESRLAATASQVAPEKQP
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggcaactactaaacccatgcgccggcgagcactcgtcgcggccttgagcacgatcctt
ttaggcgcctgcttcgccgccaatgcagccaagcccgacgagacgcagttgctgacggca
ttgcagaaagcccatccggggacgcagttctccagcgtcgcccgcacgcccatcgccggc
ctctacgaggtctggatgaacggcaatgtggcctacgtgtcggccaggcaaccacgctat
ttcctctttggtcatctgttcgacacccagagcatgagcgacctgaccgacccgaaaatg
gcgcaggccggcaaggcaaaaagccccgatgaagcgcctcagaaataccagccaaccaca
gcatcaccgatccgcttcgaacagttgcctctgagcaacgcgatcaagaccgtgcacggt
accggtcagcgccggatggccgttttcagcgaccccaactgccctttctgcaaacagttg
gaaacggagttggccagcctcgacaacctcaccatctacaccttcctgttgcctttcctg
ggtgagaccaaaccgatcgccatctggtgtgcggcggatcgtgcggcggcctggcagcgc
ctgatgcttgatggcgacgacagtctgctcaacaccggcgccgcctgcgaccacccgatc
ggtcgcaacctggcgctggcccgccaactcggcgtgcaaggcacgcccacactgatctgg
gcggatggcacccgtagcgaagggttcgttggacagaccgtgatcgaatcacgactcgcc
gcgaccgcttcacaagttgccccggagaaacagccatga

DBGET integrated database retrieval system