KEGG   Dechloromonas aromatica: Daro_2350Help
Entry
Daro_2350         CDS       T00259                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase (EC:1.1.1.35)
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
dar  Dechloromonas aromatica
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daro_2350
   01212 Fatty acid metabolism
    Daro_2350
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Daro_2350
   00650 Butanoate metabolism
    Daro_2350
  Lipid metabolism
   00071 Fatty acid degradation
    Daro_2350
   01040 Biosynthesis of unsaturated fatty acids
    Daro_2350
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Daro_2350
   00310 Lysine degradation
    Daro_2350
   00380 Tryptophan metabolism
    Daro_2350
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Daro_2350
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Daro_2350
   00281 Geraniol degradation
    Daro_2350
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daro_2350
   00930 Caprolactam degradation
    Daro_2350
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Daro_2350
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Daro_2350
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Daro_2350
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Daro_2350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2532039..2534156)
Genome map
AA seq 705 aa AA seqDB search
MAVHRLDNDVAHLVFDRQESVINKLDRATLEEIEIAVKLVAADTSLRGLLVSSAKDNFIV
GADIKEFGELFGRDEAALDAHMRWANQIFCAFEDLPIPSVVAINGMALGGGLEFALGATL
RVMAENAQIGLPEVTLGIFPGYGGTVRLGRLAGAQVAVDWVASGKPRRAAEALVAGVVDA
VSPAEQLQEQALSLLGRAMAGEIDVAAIRRKKQGAIPGHHDAVFADALTRQAKALAVHLP
AAAMAIASMARGAGKGRDLALDEERHALLKVVKTQAAGAMIQGFHNQQALKKLFGRHRAN
ARRVRSAAVLGAGIMGGGIAFTSALKGVPVRLKDISRQQLDLGMAEAKKQIGRQIKSGRV
SEAKGQQVLTSIQPQLDYAGFSDCDLVVEAIIENLKVKHAVLSELEQAVAPDTVIASNTS
SLRIDEIAMPLQRPENFVGMHFFNPVPVMALVEVIKGSRTSDVAVSTAVDYAVTMGKTPI
VVQDCPGFLVNRILTPYVRAFLDLVADGVDFVRIDRVMEVFGWPMGPAYLMDVVGIDTGC
HVFDVISAGYPAVMPIQENNALAVMVANQRYGQKNGIGFYRYENDPTGKPKKTVAEDSYP
LLKPIQLSPPREVSDEEIVERMMLSSILEAARALEDGVVATAGELDVAMLLGIGYPQYLG
GPLKYADWLGLPKVVALGEKHGHLGPQYRVTDKIRSMAASGAQFY
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atggcagtccatcgtctcgacaatgatgttgcacacctcgttttcgaccgccaggagagt
gtgatcaacaagctggatcgtgccacgcttgaagaaatcgaaattgcagtcaagctggtg
gcagccgataccagcctgcgcggcttgctggtcagcagcgccaaggataatttcatcgtc
ggcgcggatatcaaggagttcggcgaactctttggccgggacgaagcagcgcttgatgcc
catatgcgctgggccaatcagatattctgtgccttcgaggatttgccgattccaagtgtc
gtcgccatcaatggcatggcgctgggtggcggtcttgaatttgcgctgggcgcgacgctg
cgcgtgatggccgagaacgcccagattggcctacccgaggttactttgggaatttttccc
ggctacggtggcacggttcgcctggggcgtctggccggtgcacaggtcgccgtcgattgg
gtggcctccggaaagccgcggcgtgctgccgaggcgctggtcgccggggtggtcgatgcc
gtcagtccggccgagcaactgcaggagcaagccctgagtcttctgggcagggcaatggcg
ggcgagatcgatgttgcggcaattcgccggaagaagcagggcgcgattcccggtcaccat
gatgccgtcttcgccgacgccttgaccaggcaggcaaaggcactcgctgtccatttgccg
gcggcagcgatggccatcgcatcgatggcgcgcggtgcgggtaaaggccgggatctggcc
ctcgatgaagaacgccacgctttgctcaaggttgtcaaaacccaggcggcaggcgcgatg
atccagggattccataaccagcaagccttgaagaagctgttcggtcggcaccgtgccaat
gcccgtcgggtccgctcggccgcggtgcttggcgccggtatcatggggggcgggatagcc
ttcaccagcgccctgaagggcgtgccggtccggctcaaggatatttcccggcagcagctt
gatctgggtatggccgaggcgaaaaaacagattggtcgccagatcaagagcggtcgggtc
agcgaggcaaaggggcagcaggtactgacctccatccagccgcagctcgattacgccggc
ttttccgattgtgatcttgtcgtcgaggccatcatcgagaacctgaaggtcaagcatgcg
gtgctgagcgaactggaacaggcggtcgcgccggataccgtcatcgcttccaatacgtcc
agcctgcgtatcgatgaaatcgccatgcccttgcaacgcccggaaaatttcgtgggcatg
catttcttcaacccggtccccgtgatggcgctagtcgaggtcatcaagggcagcaggacc
agcgatgtcgcggtttcgactgcggtcgactatgcagtaaccatgggcaagacaccgatt
gtcgtgcaggactgcccggggtttctcgttaaccgtatcctgaccccttatgttcgggct
tttctcgacctggtggccgatggggtcgatttcgtgcgtatcgatcgcgtgatggaagtc
ttcgggtggccaatggggccggcttatctgatggacgtggtgggcattgacactggttgc
catgtcttcgatgtcatttcggccggttatcccgccgtgatgccgatccaggaaaacaat
gcgctggccgtgatggtcgccaaccagcgctatggccagaaaaacggtattggcttctat
cgctacgagaacgaccccaccggcaagccgaagaaaacggttgccgaggacagctatccc
ctgctgaaacctattcagctttcgccgccaagagaagtctcggatgaagagattgtcgag
cgcatgatgttgagttccatcctcgaagcggcccgggcattggaagacggtgttgtcgcc
acggcgggggaactcgatgtcgccatgctgctcggtatcggctacccgcaatacctcggt
ggcccgctgaaatacgccgactggcttgggcttccgaaggtcgttgcgctcggcgagaag
cacggccatctgggaccacagtatcgggtaaccgacaaaataaggagcatggcggcttcg
ggcgcgcagttctattga

DBGET integrated database retrieval system