KEGG   Dechloromonas aromatica: Daro_2382Help
Entry
Daro_2382         CDS       T00259                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dar  Dechloromonas aromatica
Pathway
dar00260  Glycine, serine and threonine metabolism
dar00750  Vitamin B6 metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01230  Biosynthesis of amino acids
Module
dar_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daro_2382
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Daro_2382
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Daro_2382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DNA_pol3_tau_5
Motif
Other DBs
NCBI-ProteinID: AAZ47118
JGI: Daro2382
UniProt: Q47DG3
Position
complement(2567391..2568818)
Genome map
AA seq 475 aa AA seqDB search
MRYLSTRGHAAPQAFCDILLGGLAPDGGLYLPESYPQISRAELDAWRQLSYADLAYEILS
KFITDIPAADLKALVAKTYTAKVYCHTRNGGDAAQITPLTKLEDGLYTQELSNGPTLAFK
DMAMQLLGNLFEYVLDKRGESINILGATSGDTGSAAEYAMRGKHNVKVFMLSPDGKMSAF
QRAQMYSLQDANIFNIAVTGMFDDAQDIVKAVSNDAAFKAKYKIGAVNSINWARVAAQIV
YYFQGYFLATRSNDEQVAFAVPSGNFGNICAGHIARQMGLPIARLVLATNENDVLDEFFR
TGVYRPRTSAETSITSSPSMDISKASNFERFVFDLVGRDPAVVKELWAKVDKGQAFDLSA
TAFWKNMPKFGFVSGKSTHIDRINTIRFAQGRYNVMLDTHTADGLKVALEHRLPNVPMIV
LETAQPAKFEETIREALGTEPVRPADLAGIENLPQRVVVMAPDVEAIKQFLVERV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatctctcgacccgcggtcacgccgcgccccaggctttctgcgacattctcctt
ggtggcctggccccggatggtggtctctacctcccggaaagctacccgcagatcagccga
gccgaacttgatgcctggcgccaactgtcgtatgccgatctggcttatgagatcctgtcc
aagttcatcaccgatattccggcagccgatctgaaggcgctggtcgccaagacctacact
gccaaggtttattgccatacccgcaacgggggggatgctgcccagatcacgccgctgacc
aagctggaagacggcctctacactcaggaactgtccaacggcccgacgctggccttcaag
gatatggccatgcagttgctcggcaacctgtttgagtacgtgctcgacaagcgtggtgag
tcgatcaacatccttggcgcgacttccggcgacaccggttcggcggccgagtacgccatg
cgcggcaagcacaacgtcaaggtcttcatgctctcgccggatggcaagatgagcgccttc
cagcgcgcccagatgtattcgctgcaggatgccaacatcttcaacattgccgtcaccggc
atgttcgacgacgcgcaggatatcgtgaaggctgtctcgaatgacgctgcgttcaaggcc
aagtacaagattggcgccgtcaattcgatcaattgggcacgggtcgctgcacagattgtc
tattacttccaaggctacttcctggctacccggtcgaacgacgagcaggtcgctttcgcc
gtgccgtcgggtaatttcggcaatatctgcgccggccacatcgctcgccagatgggcttg
ccaatcgcccgtctcgttttggccaccaatgaaaacgacgtgctcgacgagtttttccgc
accggtgtctatcgtccgcgtacctcggctgaaaccagcattacttccagcccgtcgatg
gatatttccaaggcctccaatttcgagcgctttgtgttcgacctggtcggccgtgatccg
gctgtcgtcaaggagttgtgggccaaagtggacaaggggcaggctttcgatctgtcggca
acggccttctggaaaaacatgccgaaattcgggtttgtgtctggcaagagcacgcacatc
gaccgcatcaacacgatccgttttgcgcaaggccgctataacgtgatgctcgacacccat
accgccgatggcctgaaggtggcgcttgagcatcgtctgccgaatgtgccgatgattgtt
ctggaaactgctcagccggccaagttcgaggaaacgattcgtgaggcactgggcaccgag
ccggttcgtccagctgatctggcgggtatcgagaacctgccacagcgcgtcgtggtcatg
gcgccggatgtggaggccatcaagcagttcctcgtcgagcgagtgtga

DBGET integrated database retrieval system