KEGG   Dechloromonas aromatica: Daro_2468Help
Entry
Daro_2468         CDS       T00259                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
dar  Dechloromonas aromatica
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daro_2468
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Daro_2468
Enzymes [BR:dar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Daro_2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2668984..2669904)
Genome map
AA seq 306 aa AA seqDB search
MTYNSPAMKPLGSLKYSRIRIIGAASGLGAQDQACEDGPVAFHHSQAWHELEHHPLVDWG
KTLFAPDNDGTSTTARIAELCRHLADEVALTLRADEFPVVIGGDHSIAIGTWSGLARVLG
QPFGLLWIDAHLDSHTPETSYSGAVHGMPLACLLGRGDKRLLNIGLNGPQVSAAHTVILG
PRSYEPEELEFLQRMGVRIIDSEEIQLRGFAACLDEAIAIVAGAPAGFGVTLDLDAIDPR
SAPGVGSPEPDGLTSYDVLTAMHWIAAQAGLKALEIVEYNPDRDRHGTTAALISNMIEQI
LPVGAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacctataattcgcccgccatgaaacccctcggttccctgaaatactcccgcattcgc
atcatcggcgccgccagcggcctcggcgcgcaggatcaggcttgcgaggacgggccggtg
gcgtttcatcattcgcaggcgtggcatgaactggagcatcacccgctggtcgattggggc
aagaccttgtttgcgccggataatgacggcacctcgacgactgcccggattgcagaattg
tgtcgccatctggccgacgaggtggcgctgacactgcgggctgacgagtttccggtggtc
atcggtggcgatcattccatcgccatcggcacctggagcggcttggctcgggtgctcggc
caaccctttggtctgttgtggattgatgctcatctcgacagccacacgccggaaaccagc
tattccggcgcagtccacggcatgccgctggcctgcctgctcgggcgtggcgacaagcga
ctgctcaatatcggcctgaacggcccgcaagtcagcgcggcgcacacggtcatcctcggc
ccgcgcagctatgaaccggaagagcttgaattcctgcagcggatgggcgttcgtatcatc
gatagcgaggaaatccagctgcgtggcttcgccgcctgtctggacgaggcgatagccatc
gttgccggtgcgccggccggttttggcgtaacgctggacctggatgccattgacccgagg
tcggcgccgggcgtcggcagccccgagccggatggcctgacctcgtacgacgtgctgacg
gcgatgcactggattgcggcacaggccggcctcaaggcgctggaaatcgtcgaatacaac
ccggatcgtgatcgccacggcacgacggcggcgttgatttccaacatgatcgagcagatt
ttgccggttggcgcaaagtaa

DBGET integrated database retrieval system