KEGG   Dechloromonas aromatica: Daro_2468Help
Entry
Daro_2468         CDS       T00259                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
dar  Dechloromonas aromatica
Pathway
dar00220  Arginine biosynthesis
dar00330  Arginine and proline metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01130  Biosynthesis of antibiotics
dar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Daro_2468
   00330 Arginine and proline metabolism
    Daro_2468
Enzymes [BR:dar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Daro_2468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAZ47203
JGI: Daro2468
UniProt: Q47D78
Position
complement(2668984..2669904)
Genome map
AA seq 306 aa AA seqDB search
MTYNSPAMKPLGSLKYSRIRIIGAASGLGAQDQACEDGPVAFHHSQAWHELEHHPLVDWG
KTLFAPDNDGTSTTARIAELCRHLADEVALTLRADEFPVVIGGDHSIAIGTWSGLARVLG
QPFGLLWIDAHLDSHTPETSYSGAVHGMPLACLLGRGDKRLLNIGLNGPQVSAAHTVILG
PRSYEPEELEFLQRMGVRIIDSEEIQLRGFAACLDEAIAIVAGAPAGFGVTLDLDAIDPR
SAPGVGSPEPDGLTSYDVLTAMHWIAAQAGLKALEIVEYNPDRDRHGTTAALISNMIEQI
LPVGAK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacctataattcgcccgccatgaaacccctcggttccctgaaatactcccgcattcgc
atcatcggcgccgccagcggcctcggcgcgcaggatcaggcttgcgaggacgggccggtg
gcgtttcatcattcgcaggcgtggcatgaactggagcatcacccgctggtcgattggggc
aagaccttgtttgcgccggataatgacggcacctcgacgactgcccggattgcagaattg
tgtcgccatctggccgacgaggtggcgctgacactgcgggctgacgagtttccggtggtc
atcggtggcgatcattccatcgccatcggcacctggagcggcttggctcgggtgctcggc
caaccctttggtctgttgtggattgatgctcatctcgacagccacacgccggaaaccagc
tattccggcgcagtccacggcatgccgctggcctgcctgctcgggcgtggcgacaagcga
ctgctcaatatcggcctgaacggcccgcaagtcagcgcggcgcacacggtcatcctcggc
ccgcgcagctatgaaccggaagagcttgaattcctgcagcggatgggcgttcgtatcatc
gatagcgaggaaatccagctgcgtggcttcgccgcctgtctggacgaggcgatagccatc
gttgccggtgcgccggccggttttggcgtaacgctggacctggatgccattgacccgagg
tcggcgccgggcgtcggcagccccgagccggatggcctgacctcgtacgacgtgctgacg
gcgatgcactggattgcggcacaggccggcctcaaggcgctggaaatcgtcgaatacaac
ccggatcgtgatcgccacggcacgacggcggcgttgatttccaacatgatcgagcagatt
ttgccggttggcgcaaagtaa

DBGET integrated database retrieval system