KEGG   Dechloromonas aromatica: Daro_2708Help
Entry
Daro_2708         CDS       T00259                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dar  Dechloromonas aromatica
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daro_2708
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_2708
   00620 Pyruvate metabolism
    Daro_2708
   00640 Propanoate metabolism
    Daro_2708
  Energy metabolism
   00680 Methane metabolism
    Daro_2708
Enzymes [BR:dar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Daro_2708
Lipid biosynthesis proteins [BR:dar01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Daro_2708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2901026..2902756
Genome map
AA seq 576 aa AA seqDB search
MRPPLIRKPPVDSPSAANGTTFSWAQISRELGLSTDSPINIAHLAVDRHAHSAHADKTAF
RFLGAGGSRRNLSYRELSSLTDLFGNALKALGVQKGDCVFVLCGRICELYVAVLGALKIG
AVVSPLFRSFGPEPIRSRISQAAGKVLVTTASAYQHKVAALRPELPSLRHVLLIDDLGTG
AIADTLDLQALMRAAPDTPALVPTAPEDPALLHFTSGTTGQPKGAIHVHSAVLTHYATAR
TALDLHPDDVFWCTADPGWVTGTSYGIIAPLVLGATSIVDEVDFDPLRWIHILESERVNV
WYTAPTAIRLLMKAGPELFADHRFPDLRFIASVGEALNPEAVWWGLDVLGQPIHDNWWQS
ETGGIMIANTAAQDIKPGSMGRPLPGIAAHVVRNQAGAPVTIIGTPDTVGELALETGWPS
MFRGYLDQPVRYRDCFAGNLYLTGDLVRRDADGYYWFVGRSDDVIKSSGHLIGSFEVESV
LMEHPAVAEAGVIGKPDALAGELIKAFVVLKSDIAPDENLRLELMAHARRRLGAAVAPKE
IAFAPSLPHTRSGKIMRRLLKTRELGLPEGDNSTLA
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgagaccaccactgattcgcaagccgccagttgattcgccctcggcagcgaatgggact
acgttctcctgggcacagatcagccgcgaacttggtctatccaccgacagccccatcaac
atcgctcatctggccgtcgaccgccacgcccattctgcccatgccgataaaaccgccttc
cgctttctgggtgccggtggcagcagacgcaacctcagttatcgcgaactcagcagcctg
accgatcttttcggcaacgccctcaaggcgctgggtgtgcagaaaggcgactgcgttttc
gtgctgtgcggccgtatctgcgagctttatgtggcagttctcggtgcgctcaagatcggt
gctgtggtctcgccactttttcggtccttcggcccagagccgattcgcagccgcatttcc
caggcggccggcaaagtgctggtcaccacggccagcgcctatcagcacaaagtcgcggca
cttcgccccgaactcccctcgctcaggcatgtcctgctgatcgacgacctcggcaccggc
gccatcgccgacaccctggatctgcaagccctgatgcgcgccgccccggacaccccggca
ctggtgccgaccgcccccgaagatcctgcgttgctgcatttcaccagcggaacgaccggc
cagcccaagggagccatccacgtccacagcgctgtcctgacgcactacgcgacggcacgg
accgccctcgacctgcaccctgacgacgtgttctggtgcacggccgaccccggctgggtg
accggcacctcgtacggcatcattgcgccgctggtgctgggcgccacgagcatcgtagat
gaagtcgatttcgacccactgcgctggattcacattctcgaaagcgagcgggtcaatgtc
tggtacaccgcaccgacagcaatccgactattgatgaaggccgggccggaattgtttgcc
gaccaccgtttccccgacctgcgcttcatcgccagcgtcggcgaggcgctcaatccggaa
gcggtatggtggggactggatgtgctcggccagccaatccacgacaactggtggcagagc
gagaccggcggcatcatgatcgccaacactgccgcccaggacatcaagcccggctcgatg
ggccgcccgctgccaggcattgccgctcatgtcgtccgcaatcaggcaggcgcaccggtc
acgataatcgggacgcccgacacggtgggcgagctggcgctggaaaccggctggccatcg
atgtttcgcggctatctcgaccagccggtgcgctaccgcgactgctttgccggcaatctt
tatctcaccggcgatctggtccgccgcgacgctgatggctattactggttcgtcggccgc
agcgacgacgtgatcaagtcctccggccatctgatcggctcgttcgaggtcgaaagcgtg
ttgatggaacacccagcggtcgccgaggccggcgtcatcggcaagccggatgcgctggcc
ggcgagttgatcaaagccttcgtcgttctcaaaagcgacatcgcgccggacgaaaacctg
cgccttgaactgatggcccacgcccggcggcgtctcggggcggccgtggcccccaaggaa
attgcattcgcgccatccctgccacatactcgtagtggaaaaatcatgcgccggctcctc
aagacaagggaactcggactgcccgaaggcgataattcaacgctggcgtaa

DBGET integrated database retrieval system