KEGG   Dechloromonas aromatica: Daro_2714Help
Entry
Daro_2714         CDS       T00259                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dar  Dechloromonas aromatica
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:dar01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2907986..2908588
Genome map
AA seq 200 aa AA seqDB search
MRFILVLFALLVSTTPALAAKTILIMGDSLSAGYGIRPEQAWPSLLGTRLAEKRLDYSVA
NLSISGETTAGGRSRLGPALKAHQPAVVVIALGANDGLRGLPLLQMRDNLNAMIDASRAT
GAKVLLAGMRLPPNYGPYAADFHSSFTSIAQAKKAPLIDFLLEPVAAKPQLFQADNLHPL
AEAQPLILDHLWPALAPLLK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcatcctcgtcctgtttgccctgctcgtttcaaccacgccagccctggccgcc
aaaaccatcctgatcatgggcgactcgctgtcggctggctacggcattcggcccgaacag
gcttggccttcgctgctcggcacgcgcctggccgaaaaacgtcttgattatagcgttgcc
aacctgtcaatctccggcgaaaccacggccggcggtcgctcgcgcctggggccggccttg
aaagcccaccagccggccgtggtcgtcattgccctgggcgccaacgacggcctgcgtggc
ctgccgctgctccagatgcgcgacaatctgaacgccatgattgatgcctcccgagccacc
ggcgccaaggttttgctcgccgggatgcgcctgccacccaactacggcccatatgctgca
gacttccacagcagcttcaccagtatcgcccaagccaaaaaagcgccgctgatcgacttc
ctgctcgaacccgtcgccgccaagccccagctttttcaggccgacaacctgcacccactg
gctgaagcgcagccgttgatcctcgaccatctctggcctgcccttgcacccctgttaaaa
tag

DBGET integrated database retrieval system