KEGG   Dechloromonas aromatica: Daro_2714Help
Entry
Daro_2714         CDS       T00259                                 

Definition
lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
dar  Dechloromonas aromatica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Daro_2714
Enzymes [BR:dar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Daro_2714
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Daro_2714
Lipid biosynthesis proteins [BR:dar01004]
 Fatty acid synthase
  Component type
   Daro_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2907986..2908588
Genome map
AA seq 200 aa AA seqDB search
MRFILVLFALLVSTTPALAAKTILIMGDSLSAGYGIRPEQAWPSLLGTRLAEKRLDYSVA
NLSISGETTAGGRSRLGPALKAHQPAVVVIALGANDGLRGLPLLQMRDNLNAMIDASRAT
GAKVLLAGMRLPPNYGPYAADFHSSFTSIAQAKKAPLIDFLLEPVAAKPQLFQADNLHPL
AEAQPLILDHLWPALAPLLK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcatcctcgtcctgtttgccctgctcgtttcaaccacgccagccctggccgcc
aaaaccatcctgatcatgggcgactcgctgtcggctggctacggcattcggcccgaacag
gcttggccttcgctgctcggcacgcgcctggccgaaaaacgtcttgattatagcgttgcc
aacctgtcaatctccggcgaaaccacggccggcggtcgctcgcgcctggggccggccttg
aaagcccaccagccggccgtggtcgtcattgccctgggcgccaacgacggcctgcgtggc
ctgccgctgctccagatgcgcgacaatctgaacgccatgattgatgcctcccgagccacc
ggcgccaaggttttgctcgccgggatgcgcctgccacccaactacggcccatatgctgca
gacttccacagcagcttcaccagtatcgcccaagccaaaaaagcgccgctgatcgacttc
ctgctcgaacccgtcgccgccaagccccagctttttcaggccgacaacctgcacccactg
gctgaagcgcagccgttgatcctcgaccatctctggcctgcccttgcacccctgttaaaa
tag

DBGET integrated database retrieval system