KEGG   Dechloromonas aromatica: Daro_2733Help
Entry
Daro_2733         CDS       T00259                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dar  Dechloromonas aromatica
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dar00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2928052..2928897)
Genome map
AA seq 281 aa AA seqDB search
MKPSIEDIEFHGIEALRLNGPRGVSAIVSKQGAQLLSWVSADGRERLFLSDKAVFDGSVA
IRGGVPVCFPQFSSLGDLPKHGFLRTRSWSVSTRRTGDDYALVTLECADDESTRSLWPHS
FLAELTVMLEADRIDLELAVTNTGSAPFDFTGALHSYLRVVQVEDVTLEGLHGHDYQDAV
EGDRVVRETGTELIIEKEVDRAYRDVRRPQHLKAGNLSLGIQAQGFPDVVVWNPWADRCA
ELKDMPTDGWRHMLCVEAAATRPVSLPAGEEWYGRQTLVVV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccctccattgaagatatcgaatttcacggcatcgaagccctgcgcctgaacgga
ccacgcggggtcagtgccatcgtcagcaaacagggggcgcagttgctgtcctgggtgagt
gcggatggccgcgaacgcctgttcctttccgataaggcggtgttcgacggcagcgtcgcc
attcgcggcggggttcctgtctgtttcccgcaattttccagtctgggcgacctgcccaag
catggttttttgcggactcgctcgtggtcagtcagcacccggcgtaccggcgacgattac
gcgctggtgacgctcgaatgcgctgacgatgaatcgacgcgcagcctctggccgcattcc
tttctggcggaattgacggtcatgcttgaggcggatcggattgatctggaactggcggtg
accaataccggcagtgcaccattcgactttaccggtgcgttgcactcctacttgcgcgtt
gtgcaagtcgaggatgtcacgctcgaagggttgcacggtcatgattaccaggatgccgtg
gaaggcgatcgggtcgttcgcgaaaccggcaccgagttgatcatcgaaaaggaagtggat
cgcgcctatcgcgacgtgcgccggccgcagcatctgaaggccggtaatctgagtctcggt
atccaggcccagggctttccggatgtcgtggtctggaacccatgggcggatcgttgtgcc
gaattgaaggacatgccgaccgatggctggcgccatatgctctgcgtcgaggcggcggcg
acccgtccggtcagcctgccggcgggcgaggagtggtatgggcggcagaccttggtggtg
gtctga

DBGET integrated database retrieval system