KEGG   Dechloromonas aromatica: Daro_2733Help
Entry
Daro_2733         CDS       T00259                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dar  Dechloromonas aromatica
Pathway
dar00010  Glycolysis / Gluconeogenesis
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daro_2733
Enzymes [BR:dar01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Daro_2733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AAZ47463
JGI: Daro2733
UniProt: Q47CG8
Position
complement(2928052..2928897)
Genome map
AA seq 281 aa AA seqDB search
MKPSIEDIEFHGIEALRLNGPRGVSAIVSKQGAQLLSWVSADGRERLFLSDKAVFDGSVA
IRGGVPVCFPQFSSLGDLPKHGFLRTRSWSVSTRRTGDDYALVTLECADDESTRSLWPHS
FLAELTVMLEADRIDLELAVTNTGSAPFDFTGALHSYLRVVQVEDVTLEGLHGHDYQDAV
EGDRVVRETGTELIIEKEVDRAYRDVRRPQHLKAGNLSLGIQAQGFPDVVVWNPWADRCA
ELKDMPTDGWRHMLCVEAAATRPVSLPAGEEWYGRQTLVVV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccctccattgaagatatcgaatttcacggcatcgaagccctgcgcctgaacgga
ccacgcggggtcagtgccatcgtcagcaaacagggggcgcagttgctgtcctgggtgagt
gcggatggccgcgaacgcctgttcctttccgataaggcggtgttcgacggcagcgtcgcc
attcgcggcggggttcctgtctgtttcccgcaattttccagtctgggcgacctgcccaag
catggttttttgcggactcgctcgtggtcagtcagcacccggcgtaccggcgacgattac
gcgctggtgacgctcgaatgcgctgacgatgaatcgacgcgcagcctctggccgcattcc
tttctggcggaattgacggtcatgcttgaggcggatcggattgatctggaactggcggtg
accaataccggcagtgcaccattcgactttaccggtgcgttgcactcctacttgcgcgtt
gtgcaagtcgaggatgtcacgctcgaagggttgcacggtcatgattaccaggatgccgtg
gaaggcgatcgggtcgttcgcgaaaccggcaccgagttgatcatcgaaaaggaagtggat
cgcgcctatcgcgacgtgcgccggccgcagcatctgaaggccggtaatctgagtctcggt
atccaggcccagggctttccggatgtcgtggtctggaacccatgggcggatcgttgtgcc
gaattgaaggacatgccgaccgatggctggcgccatatgctctgcgtcgaggcggcggcg
acccgtccggtcagcctgccggcgggcgaggagtggtatgggcggcagaccttggtggtg
gtctga

DBGET integrated database retrieval system