KEGG   Dechloromonas aromatica: Daro_2858Help
Entry
Daro_2858         CDS       T00259                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dar  Dechloromonas aromatica
Pathway
dar00020  Citrate cycle (TCA cycle)
dar00310  Lysine degradation
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
Module
dar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daro_2858
  Amino acid metabolism
   00310 Lysine degradation
    Daro_2858
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Daro_2858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AAZ47588
JGI: Daro2858
UniProt: Q47C43
Position
complement(3076635..3077858)
Genome map
AA seq 407 aa AA seqDB search
MSIIEVQVPQLSESVAEGTLASWKKKIGEAVARDEILIDIETDKVVLEVPSPAAGVLVEI
IKADGETVVSGELIARIDTEAKAGVAAPAAEAPKAAAAAAPAPAAAAPAGTASPSARKIL
DEKGVAAADVAGSGRGGRVTKEDAVAAAPKSGPVAAPAAAKVSLPTPPVTVALGDRTEQR
VPMTRLRARIAERLLQSQQTNAILTTFNEVNMGPMMALRKQYGEKFEKTHGVRLGFMGFF
VKAACAALQKFPVLNASVDGNDIVYHGYIDIGIAVGSPRGLVVPIIRNADQMSIAEIEKK
IAEFGAKAKDGKLTIEELTGGTFSISNGGIFGSMMSTPIINPPQSAILGIHATKDRAMVE
NGQVVVRPMNYLAMSYDHRIIDGREAVLGLVTMKEALEDPSRLLLGV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagcattattgaagtccaagttccccagctttccgagtccgttgccgaaggcacgctg
gcttcctggaaaaagaaaattggtgaagccgttgctcgcgacgagatcctgatcgacatc
gaaaccgacaaggtcgttcttgaagttccgtcgccggctgctggcgttctggttgaaatc
atcaaggctgatggcgaaaccgttgtctccggtgagctgatcgcccgtatcgataccgaa
gccaaggctggtgtcgctgctccggccgctgaagcaccgaaggctgccgccgctgctgct
ccggccccggctgccgccgcaccggctggtacggctagcccgtccgctcgcaagattctt
gacgagaagggtgttgctgctgctgatgtcgccggttccggccgtggtggtcgtgtgacc
aaggaagatgcagtcgctgctgcaccgaagtctggcccggtcgctgcgccggctgcagcc
aaggtttctctgccaaccccgccggtcacggtcgctctgggcgatcgtaccgaacagcgt
gtgccgatgacccgtctgcgcgctcgtatcgccgagcgtctgttgcaatcgcagcagacc
aacgccattctgaccacgttcaatgaagtgaacatgggcccgatgatggcgctgcgcaag
cagtacggtgagaagttcgagaagacccacggcgttcgcctgggcttcatgggcttcttc
gtcaaggctgcttgtgctgccctgcagaagttcccagtcctgaatgcttcagttgatggc
aacgacatcgtctatcacggttatatcgatatcggtatcgctgtcggttcgccgcgcggc
ctggttgtgccgatcatccgcaatgctgatcagatgagcatcgccgaaatcgagaagaag
attgccgaatttggcgccaaggccaaggatggcaagctgaccatcgaagaactgaccggt
ggtaccttctccatttccaacggcggcatcttcggttccatgatgtccaccccgatcatc
aacccgccgcagtcggccattctgggcattcacgccacgaaggaccgtgccatggttgag
aacggtcaagtcgttgtgcgtccgatgaactatctggccatgtcctacgaccaccgcatc
atcgatggccgcgaagccgtccttggtctggtgaccatgaaggaagcgctggaagatccg
tcgcgcctgctgctcggcgtctaa

DBGET integrated database retrieval system