KEGG   Dechloromonas aromatica: Daro_3083Help
Entry
Daro_3083         CDS       T00259                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
dar  Dechloromonas aromatica
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dar00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:dar00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:dar03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:dar03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:dar03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3323300..3323722
Genome map
AA seq 140 aa AA seqDB search
MTEVFFYHGASDKIAAACALLSGAYAKKKPMLVYTLEPEVASGIDRMLWTNAALSFVPHC
RADSPLAAETPILIADTLETIPQDERLMNLSQEIPPGFSRFHSLIEVVGQDESDRLAARD
RVKFYKDRGYEVRYFDLSNR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaggtatttttctaccacggcgcatccgacaagattgccgctgcctgcgccttg
ctgagcggcgcttacgccaagaaaaagccgatgttggtctacaccctcgaacccgaggtc
gccagcggcatcgatcgcatgctttggacaaacgcagcactcagctttgtgccgcactgc
cgggctgattcgccactagcggccgaaacgccgattctgattgccgacacgctggaaaca
atcccgcaagatgagcgcctgatgaatctgagccaggaaatcccgcccggtttctcacgt
tttcacagtctgatcgaggtcgtcggccaggacgaaagcgaccgccttgccgccagggat
cgcgtcaagttctacaaggatcgcggctacgaagtacgctacttcgacctcagcaaccgt
taa

DBGET integrated database retrieval system