KEGG   Dechloromonas aromatica: Daro_3101Help
Entry
Daro_3101         CDS       T00259                                 

Definition
(GenBank) Malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
dar  Dechloromonas aromatica
Pathway
dar00620  Pyruvate metabolism
dar00630  Glyoxylate and dicarboxylate metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01200  Carbon metabolism
Module
dar_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daro_3101
   00630 Glyoxylate and dicarboxylate metabolism
    Daro_3101
Enzymes [BR:dar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Daro_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI Pox_F15
Motif
Other DBs
NCBI-ProteinID: AAZ47831
JGI: Daro3101
UniProt: Q47BF0
Position
3343893..3345491
Genome map
AA seq 532 aa AA seqDB search
MALNLPQGVQITGDIKPGYETILTHDALALVAKLHRAFEGRRQELLKARVARQARIDAGE
MPDFLPETAHIRSGDWKVAPIPAALQCRRVEITGPVEAKMIINAFNSGADSYMTDFEDSN
SPNWENQIVGQMNLYKAIRRELSFKNEAGKEYKLNDKIATLQIRPRGWHLDEKHMLVDGQ
RVSGGLFDFGLVFFHNAKEQIARGAGPFFYLPKMESHLEARLWNDAFVMAQDHCGIPQGT
IKATVLIETILATFEMEEILYELRDHSAGLNAGRWDYIFSCIKKFKKNKDFCLAQRSAIT
MEVPFMRGYALALVQACHKRGAPAMGGMSALIPIKNDPVANEKALAGIRHDKTRDANDGF
DGGWVAHPGLVPIAMEEFVKVLGDKPNQFEKQVEGKFGPEQWLDFRPTTPITEAGLRNNI
NVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWVVSPKGILDDGRKVTVEMVRP
MIAEELAKVKAAVTAQGEDTASYDKAAVIFDEMSLTPEYPEFLTLPLYEAMA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccctcaaccttccgcaaggcgtgcaaatcaccggcgatatcaagccgggttacgaa
accatcctcacccatgatgcgctggcgctggtcgccaagctgcaccgcgctttcgaaggt
cgtcgccaggaactgctgaaggcccgcgttgcccgccaggcccgcatcgatgccggcgaa
atgccggatttcctgccggaaaccgcccacatccgcagcggcgactggaaggtcgccccg
atcccggccgccctgcaatgccgccgcgtggaaatcaccggcccggtcgaagccaagatg
atcatcaacgccttcaactcgggcgctgactcctacatgaccgacttcgaggattcgaat
tccccgaactgggaaaaccagatcgttggccaaatgaacctgtacaaggccatccgccgc
gaactgtcgttcaagaacgaagccggcaaggaatacaagctgaacgacaagatcgccacc
ctgcagattcgtccgcgcggttggcaccttgacgaaaaacacatgctggtcgacggtcag
cgcgtttccggtggcctgttcgacttcggtctggtcttcttccacaacgccaaggaacag
attgctcgtggcgccggccccttcttctacctgccgaagatggaaagccacctcgaagcc
cgcctgtggaacgacgccttcgtgatggcccaggaccactgcggcattccgcagggcacc
atcaaagccacggtactgattgaaaccatcctcgccaccttcgagatggaagaaatcctc
tacgaactgcgcgatcactccgctggcttgaacgccggtcgctgggactacatcttctcc
tgcatcaagaagttcaagaagaacaaggatttctgcctggcccagcgcagcgccatcacg
atggaagtaccgttcatgcgcggctacgccctggcactggtgcaggcttgccacaagcgc
ggcgccccggccatgggcggcatgtcggccctgatcccgatcaagaacgatccggttgcc
aacgaaaaggcgctggccggcatccgtcacgataagacccgcgacgccaacgacggcttt
gacggcggctgggtagcccacccgggcctggtaccgatcgccatggaagagttcgtcaag
gtactgggcgacaagccgaaccagttcgagaagcaggtcgaaggcaagtttggcccggaa
cagtggctggacttccgcccgaccactccgatcaccgaagccggtctgcgtaacaacatc
aacgtcggtatccattacctcggctcctggctggccggcaacggctgcgtgcccatccac
aacctgatggaagatgccgccaccgccgaaatctcccgctcgcaggtctggcagtgggta
gtttcgccgaagggcatcctcgacgacggccgtaaggtcaccgttgaaatggtccgcccg
atgatcgccgaggaactggccaaggtgaaggccgctgtcaccgcccagggcgaagacacc
gccagctacgacaaggctgccgtgattttcgacgaaatgtcgctgaccccggaatatccg
gagttcctgaccctgccgctgtacgaagcaatggcctaa

DBGET integrated database retrieval system