KEGG   Dechloromonas aromatica: Daro_3183Help
Entry
Daro_3183         CDS       T00259                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dar  Dechloromonas aromatica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daro_3183
Enzymes [BR:dar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Daro_3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3422229..3422705
Genome map
AA seq 158 aa AA seqDB search
MNTAYIALGANLGDPAATVRAAFGALANLPESRVVHSSSLYRTAPVGITEQPEFVNAVAQ
LETSLAPEALLDALLDIEQRFGRVRAERNGPRTLDLDILLYNDQCIDLPRLTLPHPRLHL
RAFVLYPLAEIAPGLVIPGRGSISAWLPAVANQGIVKL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaacactgcctacattgcgctgggggccaacctcggcgatccggcggccaccgtgcgc
gctgccttcggggcgctggccaacctgccggaaagccgtgttgttcatagctcttcgctg
taccgtaccgcaccggtcgggatcaccgagcaaccggaattcgtcaatgccgtcgcccaa
ctggaaaccagcttggccccggaagccctgctcgacgccctgctcgacatcgagcagcgt
ttcggccgcgtccgggccgaacgcaacggcccgcgtacgctggatctcgacatcctgctc
tacaacgaccagtgcatcgacctgccacgtctgaccttaccgcatccgcgcctccacctg
cgcgccttcgtcctctatccgctggctgaaatcgcccctggtctggtcattcccggacgc
ggcagcatttccgcctggctgccggccgtcgccaatcagggtatcgtcaagttgtga

DBGET integrated database retrieval system