KEGG   Dechloromonas aromatica: Daro_3239Help
Entry
Daro_3239         CDS       T00259                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
dar  Dechloromonas aromatica
Pathway
dar00360  Phenylalanine metabolism
dar00362  Benzoate degradation
dar00620  Pyruvate metabolism
dar00621  Dioxin degradation
dar00622  Xylene degradation
dar00650  Butanoate metabolism
dar01100  Metabolic pathways
dar01120  Microbial metabolism in diverse environments
dar01220  Degradation of aromatic compounds
Module
dar_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daro_3239
   00650 Butanoate metabolism
    Daro_3239
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Daro_3239
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daro_3239
   00622 Xylene degradation
    Daro_3239
   00621 Dioxin degradation
    Daro_3239
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Daro_3239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AAZ47969
JGI: Daro3239
UniProt: Q47B12
Position
complement(3489287..3490231)
Genome map
AA seq 314 aa AA seqDB search
MNKKLKVAIIGPGNIGTDLMIKIMRHGEHLEMGAMVGIDPQSDGLARAQRMGVATTHEGV
EGLTRLPVFADIDIVFDATSAGAHVRNDAFLRSLKPNIRMVDLTPAAIGPYCIPVVNGAA
HDEALNVNMVTCGGQATIPMVAAVSRVAKVHYGEIIASISSKSAGPGTRANIDEFTETTS
KAIEAVGGAAKGKAIIILNPAEPPLIMRDTVYCLSELVDEDEIAASVAQMAADVQKYVPG
YRLKQKVQFDIIPASRPINIPGVGQRMSGLKTSVFLEVEGAAHYLPAYAGNLDIMTSAAK
TTAERMAARILSAA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagaaattgaaggtggcgatcatcggtccgggcaatatcggcaccgacctgatg
atcaagatcatgcgccacggcgagcacctcgaaatgggcgccatggtcggtatcgacccg
caatccgatggtctggcccgggcccagcgcatgggcgtggcgacgacgcatgaaggcgtc
gaggggctgacccgtctgccggtctttgccgacatcgacatcgttttcgatgcgaccagt
gccggtgcgcatgtccgcaacgatgccttcctgcgctcgctgaaaccgaatatccgcatg
gtcgacctgacgccggcggcgatcggcccctactgcattccggtggtcaatggcgccgcc
cacgacgaagcattgaacgtgaacatggtcacctgcggcggtcaggcgaccatcccgatg
gtggcggcggtcagtcgtgtcgccaaggtgcattacggcgaaatcatcgcctcgatctcc
agcaagtcggcaggccccggcactcgggccaatatcgacgaattcaccgaaaccacctcg
aaggccatcgaggcggtcggcggcgcggccaagggcaaggcgatcatcatcctgaacccg
gccgaaccgccgctgatcatgcgcgacacggtgtattgcctgtccgagctggtcgatgaa
gacgagatcgccgcttccgtcgcccagatggcggccgacgtgcagaagtacgtgccgggc
tatcgcctgaagcagaaggtgcagttcgacatcattccggcttcgcgcccgatcaacatt
ccgggcgttggccaacgcatgagcggcctaaagacctcggtcttcctcgaagtcgaaggc
gccgcccactacctgccggcctacgccggcaacctcgacatcatgacctcggccgccaag
accacggccgagcgcatggccgcccgcatcctgtctgctgcctga

DBGET integrated database retrieval system