KEGG   Dechloromonas aromatica: Daro_3320Help
Entry
Daro_3320         CDS       T00259                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dar  Dechloromonas aromatica
Pathway
dar00071  Fatty acid degradation
dar00280  Valine, leucine and isoleucine degradation
dar00281  Geraniol degradation
dar00310  Lysine degradation
dar00360  Phenylalanine metabolism
dar00362  Benzoate degradation
dar00380  Tryptophan metabolism
dar00410  beta-Alanine metabolism
dar00627  Aminobenzoate degradation
dar00640  Propanoate metabolism
dar00650  Butanoate metabolism
dar00903  Limonene and pinene degradation
dar00930  Caprolactam degradation
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01212  Fatty acid metabolism
Module
dar_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Daro_3320
   00650 Butanoate metabolism
    Daro_3320
  Lipid metabolism
   00071 Fatty acid degradation
    Daro_3320
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Daro_3320
   00310 Lysine degradation
    Daro_3320
   00360 Phenylalanine metabolism
    Daro_3320
   00380 Tryptophan metabolism
    Daro_3320
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Daro_3320
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Daro_3320
   00281 Geraniol degradation
    Daro_3320
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daro_3320
   00627 Aminobenzoate degradation
    Daro_3320
   00930 Caprolactam degradation
    Daro_3320
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Daro_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AAZ48049
JGI: Daro3320
UniProt: Q47AT2
Position
3569252..3570073
Genome map
AA seq 273 aa AA seqDB search
MQTPGFSTLTITLSEHIAEVCLDRPDKSNAMNAAMWQEIRQAFDWVDSTPQARVAILSGA
GKNFCAGIDLAMLAGVQQQIANPDGARSREALRRLILDLQDCLSSIERCRKPVLAAIQGA
CVGGALDLVTCCDMRYAAADAIFSIKEIDLGMVADVGTLQRLPRLIGDGMARELAYTGRN
VDAAEAEKLGLVNRTFSTPATLSAEVRQLALGIAAKSPLATRGLKEVMNYSREHSVSDGL
NYVATWNAAMLLSADLNESITAQQQRRLPKFAD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgcccggattcagcaccctcaccatcaccctcagcgagcacatcgccgaggtc
tgcctcgaccgcccggacaaatcgaatgcaatgaatgcggcgatgtggcaggaaatccgc
caggccttcgactgggtcgatagcacgccgcaagcccgcgtcgcgatcctgtccggggcc
ggcaagaacttctgcgccggcatcgacctcgccatgctggccggtgttcagcaacagatc
gccaacccggacggcgcccgcagtcgcgaagccttgcgccgcctgatcctcgacctgcag
gactgcctgagcagcatcgagcgctgtcgcaagccagtgctcgccgccatccagggcgcc
tgcgtcggcggtgcgctcgatctggtcacctgctgcgacatgcgttacgccgcagcagat
gccattttctcgatcaaggaaatcgacctcggcatggtcgccgatgtcggcactctgcaa
cgcctgcctcgcctgatcggcgacggcatggcccgcgaactggcctacaccggccgcaac
gtcgatgcagccgaagctgaaaagctggggctggtgaaccggactttctccaccccggcc
acattgtcggcagaagtccgccaactggcgctgggcatcgctgccaaatccccgctcgcc
acgcgcggcctcaaggaagtgatgaactacagccgtgagcattcggtcagcgatggcctg
aactacgtcgccacctggaatgcggcgatgctgctttccgccgacctgaacgaatcgatc
accgcccaacaacaacgccgcctaccgaaattcgccgattaa

DBGET integrated database retrieval system