KEGG   Dechloromonas aromatica: Daro_3336Help
Entry
Daro_3336         CDS       T00259                                 

Definition
class II aldolase/adducin, N-terminal
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dar  Dechloromonas aromatica
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Daro_3336
Enzymes [BR:dar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Daro_3336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3590618..3591247
Genome map
AA seq 209 aa AA seqDB search
MADLRAQLISTARAMQPAGLNRGTAGNVSVRSGECFYITPTGMAYEALRDDDIPLMGLDG
SYVGSRKPSSEWRFHRDLYASRPEVGAVLHAHSPFAVSLACLRLGIPSFHYMIARFGGDS
IRCARYAVFGSESLSAAAMAAMAERKGCLLANHGMLVAGRDLAEALALAIELEELCEQYW
RASQLGSPVLLSADEMTEVLDKFKGYGQQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacctgcgcgctcaactgatcagcaccgcccgcgccatgcagccggccggcctc
aaccgcggcaccgctggcaacgtcagcgtgcgcagtggtgagtgtttctacatcacgccg
accggcatggcctacgaggccttgcgcgacgacgatatcccgctgatggggctcgacgga
tcgtacgtcggcagtcgcaagccctcatccgaatggcgcttccaccgcgacctctacgcc
agccggccggaagtcggtgccgtgctgcacgcccattcgcccttcgccgtcagcctggcc
tgcctgcgcctgggcatcccctccttccattacatgatcgcccgcttcggcggcgacagc
atccgctgcgcccgctacgccgtttttggctcggaatcgttatccgccgccgccatggcc
gccatggccgagcgcaagggctgcctgctggccaaccacgggatgctggtcgccggccgc
gacctcgccgaagcactggccctggccatcgaactggaagagctgtgcgagcaatactgg
cgcgccagtcagctcggcagcccggtcttgctgtcggccgatgaaatgaccgaggtgctc
gacaagttcaagggctacggtcagcaatga

DBGET integrated database retrieval system