KEGG   Dechloromonas aromatica: Daro_3336Help
Entry
Daro_3336         CDS       T00259                                 

Definition
class II aldolase/adducin, N-terminal
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dar  Dechloromonas aromatica
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dar00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3590618..3591247
Genome map
AA seq 209 aa AA seqDB search
MADLRAQLISTARAMQPAGLNRGTAGNVSVRSGECFYITPTGMAYEALRDDDIPLMGLDG
SYVGSRKPSSEWRFHRDLYASRPEVGAVLHAHSPFAVSLACLRLGIPSFHYMIARFGGDS
IRCARYAVFGSESLSAAAMAAMAERKGCLLANHGMLVAGRDLAEALALAIELEELCEQYW
RASQLGSPVLLSADEMTEVLDKFKGYGQQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacctgcgcgctcaactgatcagcaccgcccgcgccatgcagccggccggcctc
aaccgcggcaccgctggcaacgtcagcgtgcgcagtggtgagtgtttctacatcacgccg
accggcatggcctacgaggccttgcgcgacgacgatatcccgctgatggggctcgacgga
tcgtacgtcggcagtcgcaagccctcatccgaatggcgcttccaccgcgacctctacgcc
agccggccggaagtcggtgccgtgctgcacgcccattcgcccttcgccgtcagcctggcc
tgcctgcgcctgggcatcccctccttccattacatgatcgcccgcttcggcggcgacagc
atccgctgcgcccgctacgccgtttttggctcggaatcgttatccgccgccgccatggcc
gccatggccgagcgcaagggctgcctgctggccaaccacgggatgctggtcgccggccgc
gacctcgccgaagcactggccctggccatcgaactggaagagctgtgcgagcaatactgg
cgcgccagtcagctcggcagcccggtcttgctgtcggccgatgaaatgaccgaggtgctc
gacaagttcaagggctacggtcagcaatga

DBGET integrated database retrieval system