KEGG   Dechloromonas aromatica: Daro_3364Help
Entry
Daro_3364         CDS       T00259                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dar  Dechloromonas aromatica
Pathway
dar00020  Citrate cycle (TCA cycle)
dar00640  Propanoate metabolism
dar00660  C5-Branched dibasic acid metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
dar01130  Biosynthesis of antibiotics
dar01200  Carbon metabolism
Module
dar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daro_3364
   00640 Propanoate metabolism
    Daro_3364
   00660 C5-Branched dibasic acid metabolism
    Daro_3364
Enzymes [BR:dar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Daro_3364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Citrate_bind Cation_ATPase_N
Motif
Other DBs
NCBI-ProteinID: AAZ48093
JGI: Daro3364
UniProt: Q47AN8
Position
complement(3621437..3622597)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKQILKKFGVTVPRGIHCTTVEDAVKAAETLGGKVWVVKAQIHAGGRGKGGGV
KVATSLEKVREYAGQILGMQLVTHQTGPEGQKVRHLLIEEGADIKHEYYVAALTDRATQS
VAIMASYEGGMDIEEVAHKTPEKIVKVFVNPLVGLTDEQALTLAKGMGMNEASIPQCIET
LKSLYTCYMETDASLAEINPLIHEGDGTVKALDAKFNFDSNALYRQPEIVAMRDLDEEDP
DEVEASQFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGAEPANFLDVGGGATTEKVTE
AFKIMLKNPKVKGILVNIFGGIMKCDTIAEGVVAAAKLTHLSVPLVVRMKGTNEDLGKKI
LKDSGLPIISADSMAEAATKIVAAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcacgaatatcagggcaaacaaatcctgaagaaattcggcgttacggttccg
cgcgggattcactgcacgaccgtcgaagacgcagtcaaggcagccgaaaccctgggcggc
aaggtctgggtcgtcaaagcccagattcacgctggtggccgtggcaagggtggtggcgtc
aaggttgcaacctcgctcgaaaaagttcgcgagtacgccggccagattctcggcatgcag
ctggtcacgcaccagaccggtccggaaggccagaaggtccgtcacctgctgatcgaagaa
ggcgctgacatcaagcacgagtactacgttgctgcgctgaccgaccgcgccacccagtcc
gtcgccatcatggcgtcgtacgaaggcggcatggacatcgaggaagttgcccacaagacc
ccggaaaagatcgtcaaggtcttcgtcaatccgctggttggtctgaccgacgagcaggcc
ctgaccctggccaagggcatgggcatgaacgaagcttcgattccgcagtgtatcgagacg
ctgaagagcctgtacacctgctacatggaaacggatgcttcgctggccgaaatcaatccg
ctgatccacgaaggcgacggcaccgtcaaggcactcgacgccaagttcaacttcgactcc
aacgcgctgtatcgtcagccggaaatcgtcgccatgcgcgacctggacgaagaagatccg
gacgaagtcgaagcttcccagttcgatctggcctacatctccctcgacggcaacatcggt
tgcctggtgaatggtgccggtctggccatggcgaccatggacaccattaagctgttcggc
gccgagccggccaacttcctggacgtcggcggcggtgccacgaccgagaaggtcactgaa
gccttcaagatcatgctcaagaacccgaaggtcaagggcatcctggtcaacatcttcggc
ggcatcatgaagtgcgacaccattgccgaaggcgttgttgctgcagccaagctgacccac
ctcagcgtgccgctcgtcgtgcgcatgaagggtaccaatgaagatttgggcaagaagatc
ctgaaggattccggtctgccgatcatttctgccgattccatggccgaagccgccaccaag
atcgttgctgcggtcaagtaa

DBGET integrated database retrieval system