KEGG   Dechloromonas aromatica: Daro_3488Help
Entry
Daro_3488         CDS       T00259                                 

Definition
(GenBank) protein translocase subunit secA
  KO
K03070  
preprotein translocase subunit SecA
Organism
dar  Dechloromonas aromatica
Pathway
Quorum sensing
Protein export
Bacterial secretion system
Module
Sec (secretion) system
Brite
KEGG Orthology (KO) [BR:dar00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    Daro_3488
 Environmental Information Processing
  Membrane transport
   03070 Bacterial secretion system
    Daro_3488
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    Daro_3488
Secretion system [BR:dar02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components [MD:M00335]
   Daro_3488
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3735877..3738591)
Genome map
AA seq 904 aa AA seqDB search
MISGLLKKIFGSRNDRLIKQYSQNVKRINALEPAMQALSDEQLRAKTDEFRQRHANGESL
DDLLPEAFAVVREAGQRALGMRHFDVQMIGGMVLHDGKIAEMRTGEGKTLVGTLPAYLNA
ISGKGVHVITVNDYLATRDSDWMGRLHRFLGLTVGVNLSQMDHEAKQAAYAADITYGTNN
EFGFDYLRDNMVYTAGERVQRSLNFAIVDEVDSILIDEARTPLIISGQAEDHTDLYLRMK
DVVPNLTRAMEEKDEGDYWVDEKGHQVHLSETGYEHAEQLLAEYGLLKEGTSLYDAANIT
LMHHLNAALRGMTLFHKDQHYVVQNGEVVIVDEFTGRLMAGRRWSDGLHQAVEAKEGVQI
QAENQTLASITFQNYFRMYNKLAGMTGTADTEAYEFHQIYGLETVVIPTHRPMVRKDMND
LVYKTADEKHAAIIADIKDCAKRGQPVLVGTTSIEASELLSGLLDKESLPHQVLNAKQHA
REAEIVVQAGRPGMVTIATNMAGRGTDIVLGGNIEKQLAAIRDDESLPVEEREQKAAAMK
AEWQEVHNAVLASGGLHIIGSERHESRRIDNQLRGRAGRQGDAGSSRFYLSLDDPLLRIF
AGERLRAIMDKLKMPEGEAIEHPLVTRSLESAQRKVEARNFDIRKQLLEYDDVSNDQRKV
IYQQRNELLETDDISETITAMRQSVIAETFRTYVPAESVEEQWDMEGLERALASDLQIIA
PVAQWFKDEPTLSDEEILERITKNADEAYQAKIDLVGDGTFHQFERNVMLQSLDSHWREH
LAALDHLRQGIHLRGYAQKNPKQEYKREAFELFEGLLDLVRREVTRVVFTVQIRTPEDVE
ETAPHAEVQNVQYQHAGYDEALGEGEGAEAAGQQPADAGPKIGRNDPCPCGSGKKYKHCH
GKLS
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgatatccggcctactcaaaaagattttcggcagccgcaatgaccggctgatcaagcaa
tactcccagaacgtcaagcgtatcaacgcgctggaacctgccatgcaggccctgagcgat
gaacagttgcgggccaagacagacgagttccgccagcgtcacgccaacggtgagtcgctg
gacgatctgttgccggaggctttcgcggtggttcgcgaagccggtcagcgggcgctcggc
atgcgccacttcgacgtccagatgattggcggcatggtgctgcatgacggcaagattgcc
gaaatgcggaccggcgagggcaagacgctggtcggcaccttgccggcctacctcaatgcc
atttccggcaagggcgttcatgtcatcacggtcaacgactatctggcgacccgcgactcg
gactggatggggcgtctgcaccgcttcctcggcctgaccgtcggcgtgaacctgtcgcag
atggaccacgaggccaagcaggcggcctacgcggctgacatcacctacggtaccaacaac
gaattcggcttcgactacttgcgcgacaatatggtctatacggccggtgagcgcgtccag
cgtagcctgaatttcgccatcgtcgacgaagtggactcgatcctgatcgacgaggcgcgc
accccgctgattatttccggccaggccgaagatcacaccgatctctacctgcggatgaag
gacgtcgtgcccaatctgacgcgggcgatggaagagaaagacgaaggcgactactgggtc
gacgagaagggccatcaggtccatctctccgaaactggctacgagcacgccgagcaactg
ctggccgagtatggcctgctcaaggaaggcaccagcctttacgacgccgccaacatcacg
ctgatgcaccacctgaatgccgccctgcgcggcatgacgctgttccacaaggatcagcat
tacgtcgtgcagaacggtgaagtcgtcatcgtcgacgaattcaccggtcgtctgatggcc
ggtcgtcgctggtccgacggcctgcatcaggcggtcgaagccaaggaaggcgtgcagatt
caggccgagaaccagacgctggcctcgatcactttccagaactacttccggatgtacaac
aagctggccggcatgaccggcacggccgacactgaagcctacgaattccaccagatctac
ggtctggaaacggtcgtcatcccgacccatcggccgatggttcgcaaggacatgaacgat
ctggtctacaagacggccgacgagaagcacgcggcgatcattgccgacatcaaggattgc
gccaaacgcggccagccggtgctggttggcacgacctcgatcgaagcttcggagttgctt
tccggcttgctcgacaaggaaagcctgccgcatcaggtattgaatgccaagcagcatgcc
cgtgaagcagaaatcgtcgtccaggccggtcggccggggatggtgaccatcgccaccaac
atggccggtcgcggtaccgacatcgtgctcggcggcaacatcgaaaaacaactggctgcc
attcgcgatgacgagtcgctgccggtggaggaacgcgagcagaaggctgcggcgatgaag
gccgagtggcaggaagtgcacaatgccgtgctggcttccggcggcctgcacatcatcggt
tccgagcgtcacgaatcgcgccgtatcgacaaccagttgcgtggtcgcgccggtcgtcag
ggcgatgccggttcctcgcgtttctacctgtcgctcgatgatcccttgttgcgcatcttc
gccggcgaacgtctgcgcgccatcatggacaagctgaaaatgccggaaggcgaagcgatc
gagcatccgctcgtcacccgctcgctggagtcggcacagcgcaaggtcgaagcccgcaat
ttcgatatccgcaagcagctgcttgaatacgacgacgtctccaacgaccagcgcaaggtg
atctaccagcagcgtaacgaactgctggaaacggatgatatttccgagaccatcactgcc
atgcgccagagcgtcatcgccgaaaccttccgcacttacgtgccggcagagtcggtcgag
gagcaatgggacatggaagggctagagcgcgccctggcatccgacctgcagatcattgca
ccggtcgcccagtggttcaaggatgagccgaccctgtctgacgaggaaatcctcgagcgc
atcaccaagaatgcggacgaagcctatcaggccaagatcgatctggttggtgacggtacc
ttccaccagttcgagcgcaatgtgatgctgcaaagcctcgattcgcactggcgtgagcat
ctggcggcgctggatcacctgcgtcagggtatccacctgcgtggttatgcccagaaaaat
ccgaagcaggaatacaagcgcgaagctttcgaactgttcgaaggcttgctggatctggtt
cgccgcgaagtgacccgcgtcgtattcaccgtgcagattcgtacgccggaagatgtcgag
gaaactgcaccgcacgccgaagtgcagaacgtccagtatcagcacgccggttacgatgag
gcgctgggtgagggcgaaggcgccgaggctgctggccagcagccggcggatgccgggccg
aagatcggacgcaacgatccctgcccttgcggatcgggcaaaaaatacaaacactgccac
ggaaaactttcctga

DBGET integrated database retrieval system