KEGG   Dechloromonas aromatica: Daro_3519Help
Entry
Daro_3519         CDS       T00259                                 

Definition
(GenBank) Thioesterase superfamily
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3769432..3769920
Genome map
AA seq 162 aa AA seqDB search
MDLPKHQLAMTVLMTPDMANFSGNVHGGTILKLLDQVAYACASRYASQYVVTLSVDQVMF
RQPIHVGELVTFLASVNYTGNTSMEIGVKVLTESIRDQVVRHANSCFFTMVAVDDNGQTT
PVPPLAPKTPDEIRRYQAAQLRRELRKEFETRQKQLNAGISI
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggatttacccaaacaccaactcgccatgaccgtgttgatgacaccagacatggccaat
ttctccggcaatgttcacggcggcaccatcctcaagttgctcgaccaagtcgcctacgcc
tgcgccagccgctacgccagccaatacgtcgtcaccctgtcggtcgaccaggtcatgttc
cgccaacccatccacgttggcgaactggttaccttcctcgcctcggtgaattacaccggc
aacacctcgatggaaatcggcgtcaaagtcctgaccgaaagcatccgcgaccaggtcgtc
cgccatgccaatagctgcttcttcacgatggtcgcggtcgatgacaacggccaaaccacg
ccggtcccgccgcttgcccccaagaccccggacgaaatccgccgctaccaggccgcccaa
ctacgccgcgaactgcgcaaggaattcgaaacgcggcagaagcagttgaacgctggcatc
tccatctga

DBGET integrated database retrieval system