KEGG   Dechloromonas aromatica: Daro_3535Help
Entry
Daro_3535         CDS       T00259                                 

Definition
(GenBank) glycyl-tRNA synthetase beta chain
  KO
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
dar  Dechloromonas aromatica
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dar00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Daro_3535
Enzymes [BR:dar01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Daro_3535
Amino acid related enzymes [BR:dar01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Daro_3535
Transfer RNA biogenesis [BR:dar03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Daro_3535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3786170..3788308
Genome map
AA seq 712 aa AA seqDB search
MSSKNLLVELFVEELPPKALKKLGEAFSAALANSLKNAGLAPATASITAYASPRRLAAHV
TDVAAVAADKPVAQKLMPVAVGLDAAGNATPALLKKLAGLGIDADAAASVVASLRRENDG
KADVLFFDSLAKGATLAEGLQKAIEAALAALPIPKVMTYQLQDGWSSVNFVRPAHGLVAL
HGGDVVPVAVLGLNAGRETHGHRFEATVDPVVFANADEYASKLATDGAVIASFAERRAEI
ARQLEGAAAKAGQATGAALRPIDDEALLDEVTALVERPNVLIGQFEQEFLAVPQECLILT
MKANQKYFPLLDATGKLTNKFLVVSNISPEDASAVIGGNERVVRPRLADAKFFFDQDRKK
SLESRVIGLSKVVYHNKLGTQGERMQRVAAIARAIGESLGGEALALHAEQAAVLAKADLL
TDMVGEFPELQGTMGRYYALHDGLAAEIADAVEDHYKPRFAGDTLPRGIVGTVVALADKL
ETLVGMFGIGQIPTGDRDPFALRRHALGVIRMLAENNLALPLDHLLQTAAAPFASVDGFK
AAEAPLADFIYDRLAGSLREQGYTAQEVDAVVSQRPQRLGDIPKRLAAVRAFSGLPESAA
LAAANKRVGNILKKVENAVEAVVDNALLKEAAEIALHDALVEVVPQADAAFVTGDYSESL
QALAALRAPVDAFFDDVMVNAEDPALRANRLGLLAKLHAAMNQVADISKLSA
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaagaatctgctcgttgaactgttcgtcgaggaactgccgcccaaggccctg
aagaagcttggtgaagccttctctgccgcactggcgaattccctgaaaaatgccggcctg
gcgccggcgacagcaagcatcaccgcttacgcctcgccgcgtcgcctggctgcccacgtc
accgatgttgcagcagtcgccgccgacaagccggttgcccagaagctgatgccggttgcg
gtcggcctggatgcggccggcaacgccacgccggccctgctcaagaagctggccggattg
ggaatagatgcggacgccgccgcttccgtagtcgccagcctgcgccgcgaaaatgacggc
aaagctgacgtgctgttcttcgacagtctggccaagggcgccacgctggccgaaggcctg
cagaaggccatcgaggccgcactggccgcactgccgatccccaaggtcatgacctaccag
ttgcaggacggttggagcagcgtcaatttcgtccgtccggcccatggcctggtcgccttg
cacggcggagatgtcgtgccggtcgccgtactcggcctgaatgccggtcgcgaaacgcac
ggccaccgctttgaagccaccgtcgatccagtcgtttttgccaacgccgacgaatacgcc
agcaagctggccaccgacggcgccgtgatcgcctcgtttgccgagcgccgggccgaaatc
gctcgccagcttgaaggcgcagccgccaaggccggccaagccacaggcgctgcgcttcgg
ccgatcgacgacgaggcgctgctcgacgaagtgaccgcgctggtcgagcgcccgaacgtg
ttgatcggccagttcgaacaggagttcctcgccgtgccgcaggaatgcctgatcctgacc
atgaaggcgaaccagaagtacttcccgctgcttgatgccaccggcaagctgaccaacaag
ttcctcgtcgtcagcaatatcagcccggaagatgcctcggccgtaatcggcggcaatgag
cgtgtcgtgcgcccgcgtctggccgacgcaaagttcttcttcgaccaggaccgcaagaag
tcgctggagtcccgcgtcatcggcctgtccaaggtcgtctatcacaacaagctgggcacc
cagggcgagcgcatgcaacgcgttgccgccatcgcccgcgccatcggcgaatccttgggt
ggcgaagcgctggcgctgcacgccgagcaggcagccgtgctggccaaggccgacctgctg
accgacatggttggcgaattcccggaacttcagggcaccatgggccgctactacgcgctg
catgacggcctcgctgccgagatcgccgatgcggtcgaagaccactacaagccgcgcttt
gccggcgacaccctgccgcgcggcatcgtcggcaccgtcgtcgccctggccgacaagctg
gagacgctggtcggcatgttcggtatcggccagattccgaccggcgaccgcgacccgttt
gcgctgcgccgccatgcgctcggcgtcatccgcatgctggcggaaaacaatctggccctg
ccgctcgaccatctgctgcaaaccgccgccgcgccgttcgcctcagtcgatggcttcaag
gcggccgaagcgcccctggccgacttcatctacgaccgcctggccggcagcctgcgcgag
cagggttatacggcgcaggaagttgatgccgtcgtttcgcagcggccgcaacgcctgggc
gacatcccgaagcgactggctgccgtgcgcgccttctcgggtctgccggaatccgccgcc
ttggccgcagccaacaagcgggtcggcaacatcctgaagaaggtcgaaaacgcggtcgag
gccgtggttgacaatgcgctgctcaaggaagctgccgagatcgcactgcacgacgccctg
gtcgaagtcgtgccgcaggccgacgctgcctttgtcaccggtgactacagcgaatcgctg
caggccctggccgcgttgcgggcgccggtcgatgccttcttcgatgacgtgatggtcaat
gccgaagacccggccctgcgcgccaaccgtctcggcctgctcgccaagctgcatgcggcg
atgaaccaggtcgccgacatctccaagctgtccgcctaa

DBGET integrated database retrieval system