KEGG   Dechloromonas aromatica: Daro_3563Help
Entry
Daro_3563         CDS       T00259                                 

Definition
(GenBank) phosphate ABC transporter membrane protein 1, PhoT family
  KO
K02037  
phosphate transport system permease protein
Organism
dar  Dechloromonas aromatica
Pathway
ABC transporters
Module
Phosphate transport system
Brite
KEGG Orthology (KO) [BR:dar00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Daro_3563
Transporters [BR:dar02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Phosphate transporter [MD:M00222] [OT]
    Daro_3563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3817505..3818440
Genome map
AA seq 311 aa AA seqDB search
MTANNASDLPVVSDRLSKNAMRHVSERLIESLLFAAAAVSVLTTIGIVYVLVSESIHFFQ
NVSIVDFLTDTQWTPLFDDAHFGIMVLVSGTVVSSLVALAVAIPMGTIIAIYLSEFANGK
VREVAKPILELLGGIPTIVFGYFALLMVTPLLQKFFPELPGFSLLSAGLVMGIMIVPYIA
SLSEDAMRAVPMSLREGSYAMGGTRLYTALHVVVPAAFSGLAASYILAISRAVGETMILA
VAAGMQPNLTWNPAEPAATITSYIVQVALGDLPHGSIGYQTIFAAGLTLILITLCFNILG
QWLRRKFRENY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaataacgcttccgacctgcccgtggtcagcgatcgcctctcgaagaacgcc
atgcgccacgtcagcgaacggctgatcgagtcgctgctcttcgcggctgctgctgtttcg
gtgctgaccaccatcggcatcgtctatgtactcgtttccgagtccatccattttttccag
aatgtcagcatcgtcgacttcctgaccgacacccaatggacgccgctgttcgatgatgcc
cacttcggcatcatggtgctggtgtccggcaccgtcgtttcctctcttgtcgcactggct
gtggccattccgatggggacgatcattgccatctacctgtccgaattcgccaacggcaag
gtgcgtgaagtggccaagccaattctcgaactgctcggcggcatcccgaccatcgttttc
ggctactttgcgctgctgatggtcaccccactgctgcaaaagtttttcccggaactgccg
ggcttctcgctgctttccgccggcctggtcatgggcatcatgatcgtgccctacatcgcc
tcactgtccgaagatgccatgcgtgccgtgccgatgagcctgcgcgaaggctcctacgcc
atgggcggcacccgtctctacacggcgctccatgtcgtcgtgccggccgccttctccggt
cttgccgcctcctacatcctggccatttcgcgcgcggttggcgaaacgatgattctcgcc
gtcgccgccggcatgcagccgaacctgacctggaatccggccgaaccggctgccacgatc
acttcctacatcgttcaggtcgcgctcggcgacctgccgcacggctcgattggttaccag
accatcttcgcggccggcctgacgctgatcctgatcaccctctgcttcaacattctcggc
cagtggctgcgccgcaaattccgggagaactactaa

DBGET integrated database retrieval system