KEGG   Dechloromonas aromatica: Daro_3603Help
Entry
Daro_3603         CDS       T00259                                 

Definition
(GenBank) hypothetical protein
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AAZ48332
JGI: Daro3603
UniProt: Q479Z9
Position
complement(3865825..3867315)
Genome map
AA seq 496 aa AA seqDB search
MSATHRIRRQRWQVRTASAADAFAVRTALRQENEVSLLPALESVFAALDDGEREIHLPRL
ELAIRISLPERLAEELPVMLAEAARQALAEVIDVPSQEPAAMPRSLTPGKRLRRYLGSGQ
VDWFDADREQSELQQQLADEARQWSASPAAAWPCLLADLPAGGQARADAFFRFLQLLDIA
DRLRWWDFAARLAEAHDGESPARLALLRQMAATRPADHALRLQALGLLALSADPARSSRH
RSECLRVAQACAGQLETFAAVDQKNWLKIESWLGGESGAITLDLDNGSAKAAIDATSPPL
PEAAGVGKAPNLSTDRDGEPGQALGLPLRSAGLILLHPYLPRLFAALGWVSASHPPGEPF
PWARLPHAAALLNWLATGRDEPFEFELGTAKLLLGLQPDAPLPVAAGLIGDAEREEGEAL
LGAVILHWSALGQTTVDGLRVAFLQRGGLLYPAPDGWLLRPQGETFDLLLDRLPWGLSII
RLPWMPSSLHTEWLSA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacgcaccgtatccgccgccagcgctggcaggttcgcactgccagcgccgcc
gatgcctttgccgtgcgcacggccctgcggcaggagaacgaagtcagcctgctgcccgcg
ctggaaagcgtctttgccgcgcttgatgatggcgagcgggaaatccatttgccgcgcctc
gaactggctatccgcatttcattgcccgagcggctggccgaagagttgccggtcatgctg
gccgaggctgcccgtcaggcgctggccgaagtcatcgatgtgccgtcgcaggagccggcc
gccatgccgcgcagcctgacgccgggcaagcgattgcgccgctatctgggcagcggccag
gtcgactggttcgatgccgatcgtgaacagtccgaactgcagcagcaactggcggacgaa
gcccgccagtggagcgcctcgccggccgccgcctggccctgtctgctggccgatctgcca
gccggcggacaggcgcgcgccgatgccttcttccgcttcctgcaactgctcgatatcgcc
gaccgcctgcgctggtgggattttgccgcccgtctggccgaggcccacgatggcgaatcg
ccggcccgactggcgctgctgcgtcagatggcggcgacacgcccggctgaccatgcactc
cgcctgcaggcgctcggcttgctggcgctgtcggccgacccggcccgttcttcccgccat
cgcagcgagtgtttgcgggtggcgcaggcctgtgccgggcagctggaaacctttgctgcg
gttgaccagaaaaactggctgaaaatcgaaagctggctcggcggcgagagcggggcaata
acgcttgatctggataacggcagcgcgaaggcagcaatagatgcaacgagccctccgcta
ccggaggcagcgggagtcgggaaagcaccgaatctttcgactgatcgtgatggtgaacct
ggccaggcccttgggctgccgctgcgctcggctggattgatcctgctccatccgtatctg
ccaaggttgttcgcggcactcggctgggtcagcgccagccatccgcccggcgagcccttc
ccgtgggccaggttgccgcatgccgccgccttgctcaactggctggccaccggccgcgac
gagcctttcgaattcgaactcggcaccgccaaactgttgcttggcctgcagccggacgcc
ccgctgccagtcgccgccggcctgatcggcgatgccgaaagggaggaaggcgaggccctg
ctcggcgctgtcatcctgcactggtctgccctcggccagaccaccgtcgacggcctgcgc
gtcgccttcctgcaacgcggtggcctgctttatccggcgcctgacggctggctgttgcgg
ccgcaaggcgaaaccttcgacctcttgctcgaccgcttgccctggggcttgtccatcatt
cgcctgccctggatgcctagctctctccacaccgaatggctgagcgcctga

DBGET integrated database retrieval system