KEGG   Dechloromonas aromatica: Daro_3673Help
Entry
Daro_3673         CDS       T00259                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dar  Dechloromonas aromatica
Pathway
dar00860  Porphyrin and chlorophyll metabolism
dar01100  Metabolic pathways
dar01110  Biosynthesis of secondary metabolites
dar01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daro_3673
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Daro_3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AAZ48402
JGI: Daro3673
UniProt: Q479S9
Position
complement(3947480..3948262)
Genome map
AA seq 260 aa AA seqDB search
MTATGPLAGRTIVVTRPQAQAAPLAEAIAAAGGKPLVFPLLEISPATDPQPLIEAVARLE
SYSLAVFISPNAVDHALPAILAHGGWPVSLKPAAVGQGTARELAAKGVFGCVVPSERFDS
EALLELPEMAAESVNGRRVVIFRGDGGRELLADTLRERGASVDCITCYRRSGPSAGVQPL
LAAWQSGQLDALTVSSSEGLRYLVDRLDAEGRAFLQKTPLFVPHARIAENARALGLSNII
LTEAADAGILAGLGAYNWPA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccggcccgctcgccggccgaaccatcgttgtgacccggccgcaggcgcag
gcagcgccgctggccgaggcgattgccgccgccggcggcaagccgctggtctttccgttg
ctggaaatctcaccagcgacagatcctcagccactgatcgaggcggtagcgcgactggaa
agctactcgctggctgttttcatcagcccgaatgccgttgatcacgccttgccggcgata
ttggcgcatggcgggtggccggtcagcctgaaacccgccgccgttggccagggcacggcc
agggagctggccgccaaaggtgttttcggctgcgttgtaccaagcgaacgttttgattcc
gaggccctgctcgaacttccggaaatggctgccgaatcggtcaatggcaggcgtgtcgtc
atcttccgtggtgatggcggccgtgagctgctggccgataccttgcgcgaacgcggggca
agcgtcgattgcatcacctgctaccgccgctccggcccatccgctggcgtgcagcctctg
ctggccgcttggcaatccggacagcttgacgcattgaccgtctcaagcagcgaaggcctg
cgttatctggtcgatcggctcgacgccgaaggtcgcgccttcctgcaaaaaacaccgctc
ttcgttccccatgcccgaatcgccgaaaacgcccgggcattgggtttaagcaacattatc
ctcaccgaagcagccgacgccggcatcctcgccggcttaggtgcttataattggccggca
tga

DBGET integrated database retrieval system