KEGG   Dechloromonas aromatica: Daro_3673Help
Entry
Daro_3673         CDS       T00259                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
dar  Dechloromonas aromatica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daro_3673
Enzymes [BR:dar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Daro_3673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3947480..3948262)
Genome map
AA seq 260 aa AA seqDB search
MTATGPLAGRTIVVTRPQAQAAPLAEAIAAAGGKPLVFPLLEISPATDPQPLIEAVARLE
SYSLAVFISPNAVDHALPAILAHGGWPVSLKPAAVGQGTARELAAKGVFGCVVPSERFDS
EALLELPEMAAESVNGRRVVIFRGDGGRELLADTLRERGASVDCITCYRRSGPSAGVQPL
LAAWQSGQLDALTVSSSEGLRYLVDRLDAEGRAFLQKTPLFVPHARIAENARALGLSNII
LTEAADAGILAGLGAYNWPA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaccggcccgctcgccggccgaaccatcgttgtgacccggccgcaggcgcag
gcagcgccgctggccgaggcgattgccgccgccggcggcaagccgctggtctttccgttg
ctggaaatctcaccagcgacagatcctcagccactgatcgaggcggtagcgcgactggaa
agctactcgctggctgttttcatcagcccgaatgccgttgatcacgccttgccggcgata
ttggcgcatggcgggtggccggtcagcctgaaacccgccgccgttggccagggcacggcc
agggagctggccgccaaaggtgttttcggctgcgttgtaccaagcgaacgttttgattcc
gaggccctgctcgaacttccggaaatggctgccgaatcggtcaatggcaggcgtgtcgtc
atcttccgtggtgatggcggccgtgagctgctggccgataccttgcgcgaacgcggggca
agcgtcgattgcatcacctgctaccgccgctccggcccatccgctggcgtgcagcctctg
ctggccgcttggcaatccggacagcttgacgcattgaccgtctcaagcagcgaaggcctg
cgttatctggtcgatcggctcgacgccgaaggtcgcgccttcctgcaaaaaacaccgctc
ttcgttccccatgcccgaatcgccgaaaacgcccgggcattgggtttaagcaacattatc
ctcaccgaagcagccgacgccggcatcctcgccggcttaggtgcttataattggccggca
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system