KEGG   Dechloromonas aromatica: Daro_3807Help
Entry
Daro_3807         CDS       T00259                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K18366  acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
dar  Dechloromonas aromatica
Pathway
dar00362  Benzoate degradation
dar00620  Pyruvate metabolism
dar00621  Dioxin degradation
dar00622  Xylene degradation
dar00650  Butanoate metabolism
dar01100  Metabolic pathways
dar01120  Microbial metabolism in diverse environments
dar01220  Degradation of aromatic compounds
Module
dar_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:dar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daro_3807
   00650 Butanoate metabolism
    Daro_3807
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Daro_3807
   00622 Xylene degradation
    Daro_3807
   00621 Dioxin degradation
    Daro_3807
Enzymes [BR:dar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Daro_3807
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     Daro_3807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AAZ48535
JGI: Daro3807
UniProt: Q479E6
Position
4089816..4090733
Genome map
AA seq 305 aa AA seqDB search
MKKIRCALIGSGNIGTDLIYKIQRSPVLEPVWMVGIDPESEGLARAREMGLKTTAAGVDG
LLPHVLEDNIQIAFDATSAYVHAENSRKLNELGVMMIDLTPAAIGPLCVPPVNLKEHTEK
LEMNVNMISCAGQATIPIVHAISRIQSVSYGEIVASLASKSIGPGTRANLDEFTYTTSNA
IEIVGGARKGKALAIINPADPPMMMRNTISCLTDEEPDEPRIIESVLAMIKEVQKYVPGY
RLVNGPLFDGKRVTVFMEVAGLGDYLPKYAGNLDIMTAAATRTAEMFAEEILAGTIQLKP
VEMAV
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatacgatgcgccctgatcggctccggcaacatcggcaccgacctgatttac
aagatacagcgcagccctgtccttgaaccggtgtggatggtcggcatcgacccggaatcc
gaaggcctggcgcgcgcccgcgagatgggcctgaagaccaccgctgccggcgtcgacggc
ctgctgccgcacgtactcgaagacaacattcagatcgccttcgatgccacctcagcctat
gtccacgccgagaactcgcgcaagctgaacgaactgggcgtcatgatgatcgacctgacg
ccggcggccatcggcccgctctgcgtgccgccggtgaacctcaaggaacacaccgagaag
ctggagatgaacgtcaacatgatctcctgcgccggtcaggcaaccatccccatcgtccat
gccatctcgcgcattcagtcggtgtcgtatggcgagatcgtcgccagcctggcgtcgaag
tccatcggccccggcacccgcgccaacctcgacgaattcacctacaccacctcgaacgcc
atcgagatcgtcggcggcgcccgtaagggcaaggcactggccatcatcaatccggccgac
ccaccgatgatgatgcgcaacaccatctcctgcctgaccgacgaggaacctgacgagccg
cgcatcatcgaatcggtactggcgatgatcaaggaagtgcagaagtacgtgcccggctac
cgtctggtcaatggcccgctgttcgacggcaagcgcgtcaccgttttcatggaagtggcc
ggcctcggcgactacctgcccaagtacgccggcaacctcgacatcatgaccgcggccgcc
acgcgcaccgccgaaatgttcgccgaggaaatcctggccggcaccatccagctcaagccc
gtggagatggcagtatga

DBGET integrated database retrieval system