KEGG   Dechloromonas aromatica: Daro_3868Help
Entry
Daro_3868         CDS       T00259                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
dar  Dechloromonas aromatica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4158680..4160233)
Genome map
AA seq 517 aa AA seqDB search
MSRHPKPNIASMNDPKQPSDIAREALKRLAVRHLQPTPANYQACYNEIAGIPNILPFPEV
PLRHLATQLSPRNKRQQQSLDLLDSAIGRRSWQCVTDALNTFAQAGVVSPPAEPASSSVE
SLPGEFASKLARLVEGVLPALGDDNSRVAGMANELLLMLKQTTVELTSVQELLANLAYQM
CAAAEEQVEIKGALLKLLHMIIENIGELSVDDSWFKGQIDGLLAAVAPPLTLRHLDEMER
RLRDVMERQGRAKSRSVQAQAEMRHMLAEFIERLATMNRSSSEFEGRIEESARQIERVSS
VDDLRPLLDDVIRATHAMAEETAQSREQLKTLQDKVLITESELMQLHQELDNASALARHD
PLTDALNRKGLDEALAREVSSMRRKDLPLSISLLDVDNFKKLNDRLGHDAGDGALIHLAD
VTRSNMRPSDTLARYGGEEFVVLMPDTTLEQGIEAMTRLQRELTKAIYLSGNEKILITFS
AGVAQLAPDETGTDAIRRADQAMYLAKRSGKNRVMGG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccacccgaagccaaatatcgcgtccatgaacgacccaaaacagccctcagat
attgcgcgggaagcgctaaagcgccttgctgttcgtcacttgcagccgacgcctgccaat
tatcaggcgtgctacaacgaaatcgccggtattccgaacatccttccttttcccgaagtg
ccgttgcgccacttggcgactcaattgtcgccgcgcaataagcggcagcagcaatcgctc
gatttgctcgactcggcgattggtcggcgtagttggcagtgcgttaccgatgcgttgaat
acttttgcccaggctggcgttgtgtcgccacccgccgaaccagcctcctcgtcggtggag
tcgttgcctggcgagtttgccagcaagctcgcccgtcttgttgagggcgtgttgcctgcg
ctgggcgacgataattcgcgggtggccggaatggccaatgaattgctgttgatgctcaag
cagacgacggtcgagctaacttccgttcaggagcttctggccaatctggcttaccagatg
tgcgctgctgccgaggagcaggtcgagatcaagggggccctgctcaagctcttgcacatg
atcatcgagaatatcggcgagctgagtgttgatgacagctggttcaaggggcagatcgat
ggtcttctggcggcggttgccccgccgttgacgctgcgtcatctcgatgagatggagcgc
cgcttgcgcgacgtgatggaaaggcaggggcgcgccaagtcgcgttctgtccaggcgcag
gctgaaatgcgtcatatgctggctgagttcatcgagcgactggcgaccatgaaccgttcg
agcagcgagttcgaggggcgtatcgaggaaagtgcgcgccagatcgagagagtctctagc
gttgatgatttgaggcccttgcttgatgatgtgatcagggcgacgcatgcgatggccgaa
gaaaccgcgcaatcccgcgagcaattgaaaacgctgcaggataaggtgttgattactgaa
tcggagctgatgcagttgcatcaggagctggataacgccagtgccctggcccgccacgac
ccgctgaccgatgccttgaaccgcaaggggctggacgaggctctggcgcgcgaggtttcc
agcatgcggcgcaaggatttgcccctgtcgatcagtttgcttgacgtcgataatttcaag
aaactcaatgaccggctcggtcacgatgccggcgatggggccttgatccatctggcggac
gttacgcggagcaacatgcgaccgagtgatacgctggcccgctacggtggcgaggaattc
gtcgtcctgatgccggatacgaccctggagcagggtattgaggcgatgacccgtctgcag
cgcgagctcaccaaggcgatctacctttcgggtaatgaaaagatactgatcacgttcagt
gccggggtggctcagctggcacctgatgaaaccggtaccgatgccatccggcgagccgat
caggccatgtatctggccaagcgctccggcaagaaccgggtcatggggggctga

DBGET integrated database retrieval system