KEGG   Dechloromonas aromatica: Daro_4062Help
Entry
Daro_4062         CDS       T00259                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
dar  Dechloromonas aromatica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daro_4062
Enzymes [BR:dar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Daro_4062
DNA repair and recombination proteins [BR:dar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Daro_4062
    RecFOR pathway proteins
     Daro_4062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4359987..4360565)
Genome map
AA seq 192 aa AA seqDB search
MIGRLTGILAEKNPPQIVLDVNGVGYELDVPMSTFYNLPAAGEKTKLLTHFAVREDGHYL
YGFLTEAERFAFRQLLKVSGIGARTALSVLSGLSVGDLAAAVAQQELGRLIKIPGIGKKT
AERLLLELKGKLADATGVSLHPAVDDSKQDISNALLALGYNEKEAASAMKQLPADVSTSD
GIRAALKLLSKV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgatcggaagactgaccggtatcctcgccgaaaagaatcccccgcagatcgtgctggat
gtaaatggcgtcggctatgaactcgacgtgccgatgagcaccttctacaacctgccggca
gcgggcgagaagaccaagttgctgacgcatttcgcggtgcgcgaggacggccactatctg
tacggattcctgaccgaggccgagcgctttgccttccgccagttgttgaaagtctcgggt
atcggtgcccgtaccgcgctgtcggtgctgtccggtctgtcggtcggtgatctggcggca
gccgtggcgcagcaggaattggggcgtctgatcaagattcccggcatcggcaagaaaacg
gccgagcgcctgctgcttgaactgaagggcaagctggccgatgcgaccggcgtttcgctg
cacccggcggtcgacgacagcaagcaggatatttccaacgccctgctcgcccttggctac
aacgagaaagaagccgcctcggccatgaagcaactgccggccgatgtcagcacgtccgat
ggcatccgggcggcactcaaactgctgtccaaggtctag

DBGET integrated database retrieval system