KEGG   Desulfovibrio aespoeensis: Daes_0189Help
Entry
Daes_0189         CDS       T01382                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_0189
   00030 Pentose phosphate pathway
    Daes_0189
   00051 Fructose and mannose metabolism
    Daes_0189
   00052 Galactose metabolism
    Daes_0189
   00500 Starch and sucrose metabolism
    Daes_0189
   00520 Amino sugar and nucleotide sugar metabolism
    Daes_0189
  Nucleotide metabolism
   00230 Purine metabolism
    Daes_0189
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Daes_0189
Enzymes [BR:das01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Daes_0189
    5.4.2.8  phosphomannomutase
     Daes_0189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(207993..209360)
Genome map
AA seq 455 aa AA seqDB search
MKTINRQIFRAYDIRGIVDQDFDAQWVREFGRACGAFFARRGATRALLGHDCRASSPAYQ
QAMAQGLTATGLDVVYLDQVSTPVFYFAARHLGFDAGVMITASHNPSEYNGFKVWSGRST
IHGQDVLDIHDLMVAGEYPVGAGLTSCHDILPTYRQDLLSRVTLARPLKVVVDGGNGAAG
DLTADILEAAGAEVIRLYCEPDGSFPNHHPDPVVEANMEDLKATVVAMGADFGVGLDGDG
DRIGAVDETGRLMYGDQLLAIYARDLLRDLPGAGVVADVKCSPLLFRDVEAHGGKAEMCV
TGHSIVKDRMIETGAAIGGEMSGHMFFFHGYHGFDDATFGALKLAGIVSRADRPLSAFLA
DWPTVYNTPEIRMDCAETIKFEVVARAQAYFKARYSVIDMDGARVEFGDGWGLVRASNTQ
GALVLRFEAESQARLDEIRQIMETPIRGWIKELGG
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgatcaacagacaaatattccgtgcctacgacatccggggcatcgtggaccag
gatttcgacgcccagtgggtgcgcgagtttggcagggcgtgcggtgccttctttgcccgg
cgcggcgccacccgcgccctgctcggccacgactgtcgggccagctcgcccgcctaccag
caggccatggcccaggggctgaccgccaccgggctcgacgtggtctatctcgaccaggtc
tccaccccggtcttttattttgcggcccgccacctgggctttgacgcgggcgtcatgatc
actgccagccataatcccagcgaatacaacgggttcaaggtctggagcgggcgctccacc
atccacggccaggacgtcctggacatccacgacctgatggtggccggggaataccccgtg
ggcgcgggcctgacctcctgccacgacattcttcccacctatcgccaggatctgctctcc
cgcgtcactctggcccggcctctcaaggtggtggtggacggcggcaacggcgcggcgggc
gacctgaccgccgacatcctcgaggctgccggggccgaggtgatccgcctctactgcgag
ccggacggctcctttcccaaccaccacccggacccggtggtggaggccaacatggaagac
ctcaaggccacggtggtggccatgggcgcggattttggcgtggggcttgacggcgacggc
gaccgcatcggggccgtggacgagacaggccgcctgatgtacggcgaccagctcctggcc
atctatgcccgcgatctgctgcgcgacttgcccggcgcgggcgtggtggccgatgtcaaa
tgcagccccctgctcttccgcgacgtggaggcccacggcggcaaggccgagatgtgcgtg
accggccactccatcgtcaaggaccggatgatcgagaccggcgcggccatcggcggcgag
atgtccggccacatgttcttcttccacggctaccacggctttgacgacgccacctttggc
gcgctcaagctggcgggcatcgtgagccgggccgaccgccccctgtccgccttcctggcc
gactggcccacggtctacaacaccccggaaatccgcatggactgcgcggaaaccatcaag
ttcgaggtggtggcccgcgcccaggcctacttcaaggcgcgctacagcgtcatcgacatg
gacggcgcgcgggtggaattcggcgacggctggggactggtccgcgcctccaacacccag
ggtgcgctggtgctgcgcttcgaggccgagtcccaggcccggctggacgagatcagacag
attatggagacccccatccggggctggatcaaggagcttggaggctga

DBGET integrated database retrieval system