KEGG   Pseudodesulfovibrio aespoeensis: Daes_0665Help
Entry
Daes_0665         CDS       T01382                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00010  Glycolysis / Gluconeogenesis
das00620  Pyruvate metabolism
das00640  Propanoate metabolism
das00680  Methane metabolism
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
das01120  Microbial metabolism in diverse environments
das01130  Biosynthesis of antibiotics
das01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daes_0665
   00620 Pyruvate metabolism
    Daes_0665
   00640 Propanoate metabolism
    Daes_0665
  Energy metabolism
   00680 Methane metabolism
    Daes_0665
Enzymes [BR:das01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Daes_0665
Lipid biosynthesis proteins [BR:das01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Daes_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADU61683
JGI: Daes_0665
UniProt: E6VZG9
Position
complement(733636..735555)
Genome map
AA seq 639 aa AA seqDB search
MDQSGALDSLLTEERVLRPLPQLVIEANINPQELEAARKFAAMDHLGYWEEAADELDWFK
KWDQVLDDKDAPFYRWFAGARCNIVYNALDRHIETANKNKLALIWEGEPGDSRKYTYFEL
YREVNRFANALRSLGIRKGDRVVIYMPPLPETVIAMLATAKIGAIHSLVFAGFSAKALRQ
RINDCQARLLITSDGFYRNGHIINLKETADAALVGSCADCVESMVVVRRCNIGVDMVDGR
DFHYDDLIRQERNEAPTEVMDAADPLFMLHTSGTTGKPKGIVHSHAGYMVGVHRTLTSVF
DIKPTDIFWSTADPGWVTGHSAGIYGPLLAGTTTVMYEGHPNYPQADRLWSIVARYGVTI
FYTVPTMIRMLMRFGAQYPKQHDLSSLRLLGSVGEPISPETWIWLYKNIGRSECPVLDTW
WQTETGMFMIAPLPISLLKPGSVTKPLPGVEAEVVDREGNPMPTGKGGLLVITKPWPAMM
TGLWNDDDRYREYWTKIPGVYYAGDVARKDEDGYIWMQGRADDVINIAGHRIGSAEVEAA
FAAHPAVCEVAVIGVPDRIKGEAAKGFVVLNDGFEASDGMIKELKKTVRNELGPVAVIKS
IEFRQELPKTRSGKIMRRVLKAEETGTGIGDLTGGEDEE
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggatcagtcaggcgcactcgacagcttgcttaccgaggaacgggtactccgcccgttg
ccccaattggtcatcgaggccaacatcaatccccaggagctggaggccgcgcgcaaattc
gcggccatggaccatcttggctactgggaggaggccgccgacgagctggactggttcaag
aaatgggaccaggtgctcgacgacaaggacgcgcccttttaccgctggtttgccggggcg
cgctgcaacatcgtctacaacgcgctcgaccgccacatcgagaccgccaacaagaacaag
ctcgccctgatctgggagggcgagcccggcgactcgcgcaaatacacctatttcgagctc
taccgcgaggtcaaccggttcgccaacgccctgcgctcgctgggtatccgcaagggcgac
cgggtggtcatctacatgccgcccctgcccgagaccgtcatcgccatgctggccacggcc
aagatcggggccatccactccctggtctttgcgggcttctcggccaaggcgctgcgccag
cgcatcaacgactgccaggcccggctgctcatcacctcggacggcttctaccgcaacggc
cacatcatcaacctcaaggagaccgcggacgccgccctggtcggctcgtgcgccgactgc
gtggaatccatggtcgtggtgcgccgctgcaacatcggcgtggacatggtcgatggccgc
gattttcactacgacgatctcatccgccaggagcgcaacgaggcgcccaccgaggtcatg
gacgcggctgatccgctcttcatgctccacacctcgggcaccacgggcaagcccaagggc
attgtccactcccacgcgggctacatggtgggcgtgcaccgcaccctgacctcggtcttt
gacatcaagcccacggacatcttctggagcaccgccgaccccggctgggtcacgggccac
agcgcgggcatctacgggccgctcctggcgggcaccaccacggtcatgtacgagggccat
cccaactatccacaggccgaccggctctggtccatcgtggcccggtacggggtgaccatc
ttctacaccgtgccgaccatgatccgcatgctcatgcgctttggcgcgcagtatcccaag
cagcacgatctctccagcctgcgcctgctcggctcggtgggcgagcccatctcgcccgag
acctggatatggctctacaagaacataggccgcagcgaatgcccggtgctcgacacctgg
tggcagaccgagaccggcatgttcatgatcgcgcccctgcccatctcgctgctcaagccc
ggctcggtgaccaagcccctgcccggcgtggaggccgaggtggtggaccgcgagggcaac
cccatgccaacgggcaagggcggcctcttggtcatcaccaaaccctggcccgccatgatg
accgggctgtggaacgacgacgaccgctacagggaatactggaccaagatccccggcgtc
tactacgcgggcgacgtggccaggaaggacgaggacggctacatctggatgcagggccgt
gccgacgatgtcatcaacatcgccgggcaccgcatcggctcggcagaggtagaggccgcg
ttcgccgcccacccggcagtatgcgaagtggcggtcatcggcgtgccggaccggatcaag
ggcgaggcggccaaggggtttgtcgtgctcaatgacgggttcgaggccagcgacggcatg
atcaaggaactgaaaaaaaccgtgcgcaacgagcttgggccggtggcggtgatcaagtcc
atcgagtttcgccaggagttgcccaagacgcggtccgggaagatcatgcggcgggtgctc
aaggccgaggagaccgggacagggattggggatttgaccggcggggaggatgaggagtag

DBGET integrated database retrieval system