KEGG   Pseudodesulfovibrio aespoeensis: Daes_0716Help
Entry
Daes_0716         CDS       T01382                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
das  Pseudodesulfovibrio aespoeensis
Pathway
das00250  Alanine, aspartate and glutamate metabolism
das01100  Metabolic pathways
das01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Daes_0716
Enzymes [BR:das01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Daes_0716
Peptidases [BR:das01002]
 Cysteine Peptidases
  Family C44
   Daes_0716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC DUF3700 NAD_synthase SNF2_N
Motif
Other DBs
NCBI-ProteinID: ADU61733
JGI: Daes_0716
UniProt: E6VZL9
Position
794444..796324
Genome map
AA seq 626 aa AA seqDB search
MCGITGFLANSGWPFECIDSMAGAIAHRGPDDSGSWADPGAGIALGHRRLSILDLSALGR
QPMVSNCGRFVIAYNGEVYNFRTIRTELRALGHEFKGDSDTEVIVAGMAQWGVQEAVKRF
VGMFAFALWDRGERALYLVRDRLGIKPLYYGRVANAFVFGSELKALRAFPGFCNDIDRGA
LSLYFRHNYIPAPHSIYQGVRKLEPGSILRVQPGGEPSVIRYWSADEVWDRGLQAPFAGS
MDEGAERLHDLLADAVGLRMISDVPIGAFLSGGIDSSLVVALMQAQSSRPVKTFSIGFRE
QEFDEAHYAKAVAAHLGTDHTELYVTAEDMLSVIPLLPKIWDEPFADSSQIPTYCVSRLA
GGHVTVSLSGDGGDELFAGYDRYFWSRRVRRLLAVPLPLRKLIVAGLPRSVLASLGSLGR
KAAWRLDGLGCASFAELYRFLVSHQKKPAEFVLGGFEPEAELSRNADARGDIFHRMTLWD
TVSYLPDDILTKVDRASMAVGLEARVPILDHRVVEFAASLPLSMKVEKGQGKRILRKVLS
RHVPDALVDRPKKGFGVPMERWLGRELRDWSESLLDQNRLVRQGYLDHQAVRRMWERFLA
GDTYYCHFLWDILMFQAWLAEWEENR
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
gtgtgcggaataaccggatttcttgccaattccggctggccgttcgaatgcattgattcg
atggcgggtgccattgcccatcgggggccggatgattccggctcgtgggccgaccctggg
gccgggatagcccttgggcaccgaaggctgtcaatcctcgacctctccgcgcttggccgc
cagcccatggtctcgaactgcggtcgattcgtcatcgcctacaacggcgaggtctacaac
ttcagaacgattcggaccgagctgcgagcccttggccatgagttcaagggcgactcggat
accgaggtcattgtcgctggcatggcccagtggggggtgcaggaggcggtcaagcggttc
gtgggcatgttcgccttcgcgctctgggacaggggggagagggcgctgtatctcgttcgt
gaccgcctcggcataaagcctctgtactacggacgagtcgccaacgcctttgtcttcggt
tcggagctcaaggcgctccgggccttccccggattctgcaacgacatagaccggggcgcg
ctctctttgtatttccggcataattatataccggctccacattcaatatatcagggagtg
cgcaagctggagcccgggagcatcctgcgggttcagccgggcggcgagccctcggtcatc
aggtactggtctgccgacgaggtgtgggatcgaggtcttcaggcgccctttgccgggagc
atggacgaaggtgcagagcgtctgcacgatctgcttgcggatgcggtcgggctgcgcatg
atctccgatgtgcccataggagcattcctttcgggcggtatcgactcctccctggtggtt
gccttgatgcaggcccagagcagcaggccggtcaagacgttttccattggcttccgtgag
caggagtttgacgaagcccattatgcgaaggcggttgccgcccacctggggaccgaccac
accgagctctacgtgaccgccgaagacatgctctccgtcatcccgctgctgccgaagata
tgggacgagccctttgcagactcttcacaaatacccacctattgcgtgtccaggctggct
ggcgggcacgtgaccgtcagcctctcgggagacggaggagatgagctgttcgcgggctac
gacaggtatttctggagccgcagggtgcgccgccttctggctgttccgttgcccttgcgc
aagctgattgtcgccggtctgccccgatccgtgctcgcctcgctcggctccctgggacgc
aaggcggcctggcgcctcgatgggttgggatgcgccagtttcgcagaactctatcgcttc
ctcgtgtcgcatcaaaagaaaccggcggaattcgtgctgggtggcttcgagcccgaggcc
gagctctcgcgcaacgctgacgcgcgcggcgacatctttcatcgcatgaccctctgggac
acggtgagctatcttccggacgacatcctgaccaaggtggaccgtgccagcatggccgtg
ggtcttgaggcgcgcgtgccgattctcgatcaccgcgtggtggagttcgccgcctcgctt
cctctttcgatgaaggtggagaagggccaggggaagcggattctgcgcaaggtgttgtcg
cgccatgtgcccgacgccctggtggaccgccccaagaaaggcttcggagttcccatggag
cgctggctgggacgggagctgcgggattggagtgagtccctgctggatcagaaccgcctc
gtacggcagggctaccttgaccaccaggccgtgaggcgcatgtgggaacgatttcttgca
ggcgacacgtactattgccactttctctgggacatccttatgtttcaggcgtggctggcc
gaatgggaggaaaatcggtga

DBGET integrated database retrieval system