KEGG   Desulfovibrio aespoeensis: Daes_0891Help
Entry
Daes_0891         CDS       T01382                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
das  Desulfovibrio aespoeensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Daes_0891
Enzymes [BR:das01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Daes_0891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(988000..988857)
Genome map
AA seq 285 aa AA seqDB search
MAPHFLEGEIPNEKPDKAAVHIIPVPLETSTSYGAGTAAGPAAIIEASKQLELWNGSWVP
ASGGVHTADPVDCSKEIAKTLDRIEDAVAYALECEALPLVLGGEHTVTLGALRAMKLKYG
RFGVVQFDAHADLRNTYQGSPYSHACVMRRAMDDLRVPVFQVGVRAMCAEEADYRKAQAV
PCLDARKMHLKGIPTQLLPADFPERIYITFDVDGLDPSVIRATGTPVPGGLGWHDALTLL
ERTVAGRHVIGADVVELAPAQGDHASDFAAALLAYCLMGLSLPRE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcattttctggaaggggagattcccaacgaaaaaccggacaaggccgctgtc
cacatcatccccgtgccgctagagacctcgacatcctacggcgcgggcacggctgccggt
ccggcggccatcatcgaggcgtccaaacagctggaactgtggaacggctcctgggttccg
gcctctggcggcgtgcataccgccgatcccgttgactgctccaaggagatcgccaagacc
ctggaccgcatcgaggacgccgtggcctacgccctggagtgcgaggccctgccactggtt
ctgggcggcgagcacaccgtcaccttaggcgcgctgcgcgccatgaagctgaaatacggc
cggttcggcgtggtccagttcgacgcccatgccgacctgcgcaatacctaccagggctcg
ccctacagccacgcctgcgtcatgcgccgggccatggacgatctgcgcgtgccagtcttc
caggtgggcgtgcgcgccatgtgcgccgaagaggccgactaccgcaaggcccaggcggtc
ccgtgcctcgacgcccgcaagatgcacctcaagggcatccccacccagctgctgcccgcc
gattttcccgagcgcatctacatcacctttgacgtggacggcctcgacccgtccgtgatc
cgggccaccggcaccccggtgcccggcggcctgggctggcacgacgccctgaccctgctt
gagcggaccgtggccggcaggcatgtcatcggcgcggacgtggtcgaactggccccggcc
cagggcgaccacgcctcggattttgccgccgccctgctggcctactgtctgatgggcctg
agcctgcccagggaataa

DBGET integrated database retrieval system