KEGG   Desulfovibrio aespoeensis: Daes_0945Help
Entry
Daes_0945         CDS       T01382                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daes_0945
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daes_0945
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daes_0945
Enzymes [BR:das01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daes_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1065029..1065790)
Genome map
AA seq 253 aa AA seqDB search
MNPMQSKIEAAKAKGKVALIPFLPAGFPNREQFWKELEQLDAAGAAVIEIGMPFSDPVAD
GPVVEKASLKCLEDGINLTWIFDGLKARKGQFNAALLLMGYLNPVYQYGLDAFGADCAAA
GVSGLIIADLPHEESDFVKQAMAPHNVALVPLIGLNTSPERMRLYAQNAQGFCYFVSVLG
TTGQRDSLPERIREKLAEARSIFTIPIALGFGIKHPDQLANFTGLMDAAVFGSALITHIA
TGHTSAQFMEPWQ
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaatccaatgcaatcgaaaatagaagcagccaaggccaagggcaaggtcgccctcatc
ccgttcctgcccgccggattccccaatcgggaacaattctggaaggaacttgaacagctc
gacgccgcaggcgcggcagtcatcgagataggcatgcccttctccgaccccgtggccgac
ggcccggtggtggaaaaagcgtccctcaagtgccttgaggacggcatcaacctgacctgg
atatttgacgggctcaaggcgcgcaaaggccaattcaacgccgccctgctgctcatgggc
tacctcaaccccgtctaccagtacggtctcgacgcctttggcgcagactgcgccgccgcc
ggagtctccggcctgatcatcgccgatctgccccacgaggaatccgacttcgtcaaacag
gccatggccccccacaacgtggccctggtcccgctcatcggcctgaacaccagcccggag
cgcatgcgcctctacgcacaaaacgcccaaggcttctgctacttcgtctcggtgctgggc
accaccggccagcgtgactccctgcccgaacgcatccgcgaaaaactcgccgaggcgcgc
tccatcttcaccatccccattgcgctgggctttggcatcaaacaccccgaccagctcgcc
aacttcaccgggctcatggacgccgccgtgttcggctccgctctcatcacccacatcgcc
accggccacaccagcgcccagttcatggagccgtggcaataa

DBGET integrated database retrieval system