KEGG   Desulfovibrio aespoeensis: Daes_0946Help
Entry
Daes_0946         CDS       T01382                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
das  Desulfovibrio aespoeensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:das00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daes_0946
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daes_0946
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daes_0946
Enzymes [BR:das01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daes_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1065802..1066965)
Genome map
AA seq 387 aa AA seqDB search
MKKGYFGDFGGQFIPELLMPPLLELEQAMETILPTEEFQTRFIGMLKENVGRPSAITYCP
NLSRDLGLDLWLKREDLNHSGAHKINNTLGQGLLAKMMGKTTLLAETGAGMHGVATAVAA
AMLDMKCLVYMGATDVVRQSPNVNRMRLMGAEIVPVQSGTKTLKDAINEALRRWLSDQET
THYCFGTAAGPHPFPTLVRTFQQVISREARQQFMERNNGALPDVVVACVGGGSNAIGMFH
HFVPDPSVTIIGVEAAGTGEPGCDNSAPLNLGTNGVLHGMKTKLLQTSEGQIKPSHSIAP
GLDYPGVGPEHAHLHDTGRATYVTINDAQAINAFKTLSRREGIIPALESSHAVAYAIEHR
AELKGKSVLVCLSGRGDKDMGIVDSIL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaggatacttcggcgatttcggcggccagttcatccccgagctgctcatgccg
ccccttctggagcttgagcaggccatggagaccatcctccccacagaggagttccagacc
cgcttcatcggcatgctcaaggaaaacgtgggccgcccctcggccatcacatactgcccc
aacctctcgcgcgacctcgggctcgacctgtggctcaagcgcgaagacctgaaccactcg
ggcgcgcacaagatcaacaacacgctcggccaggggctgctcgccaagatgatgggcaag
accaccctgctggccgagaccggcgcgggcatgcacggcgtggccaccgccgtggccgcc
gccatgctcgacatgaaatgcctcgtctacatgggcgccaccgacgtggtccgccagtcg
cccaacgtcaaccgcatgcgcctcatgggcgcggaaatcgtgcctgttcagtccggcacc
aagaccctcaaggacgccatcaacgaggcgctgcgccgctggctctcggaccaggaaacc
acccactactgctttggcaccgcagccggaccgcatcccttccccaccctggtgcgcacc
ttccagcaggtcatctcgcgcgaggcgcgccagcagttcatggagcgcaacaacggcgcg
ctgcccgacgtggtcgtggcctgcgtgggcggcggctccaacgccatcggcatgttccac
cacttcgtgcccgatccctcggtgaccatcatcggggtcgaggccgcaggcaccggcgag
ccgggctgcgacaactccgccccgctcaacctcggcaccaacggcgtgctgcacggcatg
aaaaccaagctgctccagacctccgaaggccagatcaagccctcccactccatcgccccc
ggcctcgactaccccggcgtcggacccgaacacgcccacctgcacgacacgggccgcgcc
acctatgtgaccatcaacgacgcccaagccatcaacgccttcaagaccctctcccggcgc
gaaggcatcatcccggccctcgaatcgtcccacgccgtggcctacgccattgagcaccgg
gcagaactcaagggcaagtccgtcctcgtctgcctgtccgggcgcggcgacaaggacatg
ggcatcgtcgattccatcctctag

DBGET integrated database retrieval system